| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW256006.1 | internal | 183 | 1-549(+) |
Amino Acid sequence : | |||
| SYPIKLFYTSNMPIILQSALVSNLYFISQLLYKKYGGNFLVNLLGTWKESEYSGQSIPVGGLAYYVTAPSSLADVAANPFHALFYIVFMLSACALFSKTWIEVSGSSAKDVAKQLKEQQM VMPGHRDSNLQKELNRYIPTAAAFGRICIGALTVLGDFMGAIGSGTGILLAVTSSINISKPLK | |||
Physicochemical properties | |||
| Number of amino acids: | 183 | ||
| Molecular weight: | 11,652.705 | ||
| Theoretical pI: | 8.145 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22460 22960 | ||
| Instability index: | 54.074 | ||
| aromaticity | 0.140 | ||
| GRAVY | 0.380 | ||
Secondary Structure Fraction | |||
| Helix | 0.400 | ||
| turn | 0.180 | ||
| sheet | 0.200 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW256006.1 | 5prime_partial | 100 | 3-305(+) |
Amino Acid sequence : | |||
| LPDQAFLYLQHAHYSSVCPCIQSLLHFSVVIQEIWWKFLGQLVGYMEGIRIFRTIDSCWRPCLLCDCTIKLSRCGSKSFPCTFLYSIHAFRVCPLLKDMD* | |||
Physicochemical properties | |||
| Number of amino acids: | 100 | ||
| Molecular weight: | 11,652.705 | ||
| Theoretical pI: | 8.145 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22460 22960 | ||
| Instability index: | 54.074 | ||
| aromaticity | 0.140 | ||
| GRAVY | 0.380 | ||
Secondary Structure Fraction | |||
| Helix | 0.400 | ||
| turn | 0.180 | ||
| sheet | 0.200 | ||