Acc_NO	ORF type	length	start-end position (strand +/-)
>AW256007.1	internal	117	3-353(+)
Amino Acid sequence :
DAFPYLGWLDLGGHERRMKRTAEEMDELVGEWLAEHRRKEYSGEGKAQDFMDVMLSEVKGANFECEYDVDTIIKATCGTLIAGGTDTTAVVFIWALALLLNNPHVLQKAQHELDTHV
Physicochemical properties
Number of amino acids:		117
Molecular weight:		13,179.752
Theoretical pI:		4.779
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		20970 21095
Instability index:		26.915
aromaticity		0.085
GRAVY		-0.280
Secondary Structure Fraction
Helix		0.299
turn		0.145
sheet		0.342