| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW256009.1 | 5prime_partial | 144 | 2-436(+) |
Amino Acid sequence : | |||
| RKQAPMADAQRYALVTGANKGIGFEICRQLAEKGIIVILTSRNEKRGLEARKKLLKELNVSENRLVFHQLDVTDLASVAAVAVFIKSKFGKLDILVNNAGVSGVEMVGDVSVFNEYIEAD FKALQALEAGAKEDRHLSQKPMEK* | |||
Physicochemical properties | |||
| Number of amino acids: | 144 | ||
| Molecular weight: | 15,841.164 | ||
| Theoretical pI: | 9.019 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 22.142 | ||
| aromaticity | 0.056 | ||
| GRAVY | -0.133 | ||
Secondary Structure Fraction | |||
| Helix | 0.313 | ||
| turn | 0.181 | ||
| sheet | 0.326 | ||