Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW256009.1 | 5prime_partial | 144 | 2-436(+) |
Amino Acid sequence : | |||
RKQAPMADAQRYALVTGANKGIGFEICRQLAEKGIIVILTSRNEKRGLEARKKLLKELNVSENRLVFHQLDVTDLASVAAVAVFIKSKFGKLDILVNNAGVSGVEMVGDVSVFNEYIEAD FKALQALEAGAKEDRHLSQKPMEK* | |||
Physicochemical properties | |||
Number of amino acids: | 144 | ||
Molecular weight: | 15,841.164 | ||
Theoretical pI: | 9.019 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
Instability index: | 22.142 | ||
aromaticity | 0.056 | ||
GRAVY | -0.133 | ||
Secondary Structure Fraction | |||
Helix | 0.313 | ||
turn | 0.181 | ||
sheet | 0.326 |