Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW256012.1 | internal | 146 | 3-440(+) |
Amino Acid sequence : | |||
ASMRWRRQFSTDLSEETTGDAKFMDSWKKLNPNMDPPKTPSAYMTPRPPTPSTIPSKLTVNLVLPYDSVLSGKEVDMVIIPATTGQMGVLPGHVATIAELKPGILSVHEGNDVTKYFLSS GFAFVHANSIADIIAIEGTPIDRIDP | |||
Physicochemical properties | |||
Number of amino acids: | 146 | ||
Molecular weight: | 15,867.998 | ||
Theoretical pI: | 5.529 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15470 | ||
Instability index: | 36.642 | ||
aromaticity | 0.068 | ||
GRAVY | -0.162 | ||
Secondary Structure Fraction | |||
Helix | 0.281 | ||
turn | 0.288 | ||
sheet | 0.219 |