| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW256015.1 | internal | 156 | 2-469(+) |
Amino Acid sequence : | |||
| STPLLHIDLQIYASCFERRFNMDTFLFTSESVNEGHPDKLCDQVSDAILDACLEQDPESKVACETCTKTNMVMVFGEITTKAKVDYEKIVRDTCRGIGFTSPDVGLDADNCKVLVNIEQQ SPDIAQGVHGHLTKKPEEIGAGDQGHMFGYATDETP | |||
Physicochemical properties | |||
| Number of amino acids: | 156 | ||
| Molecular weight: | 12,953.373 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 17990 | ||
| Instability index: | 57.306 | ||
| aromaticity | 0.062 | ||
| GRAVY | 0.158 | ||
Secondary Structure Fraction | |||
| Helix | 0.354 | ||
| turn | 0.230 | ||
| sheet | 0.292 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW256015.1 | 5prime_partial | 113 | 3-344(+) |
Amino Acid sequence : | |||
| PLLSSILICRSTPLVLKEDSIWIPSYLPRSLLMRDTPTNSATKSRMPFLMLALSRIQRAKLLVKLAQRLTWSWFLVRSQPRLRSTTRRSFVILAGVSDSHRLMLVSMLTTARS* | |||
Physicochemical properties | |||
| Number of amino acids: | 113 | ||
| Molecular weight: | 12,953.373 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 17990 | ||
| Instability index: | 57.306 | ||
| aromaticity | 0.062 | ||
| GRAVY | 0.158 | ||
Secondary Structure Fraction | |||
| Helix | 0.354 | ||
| turn | 0.230 | ||
| sheet | 0.292 | ||