Acc_NO	ORF type	length	start-end position (strand +/-)
>AW256016.1	internal	137	3-413(+)
Amino Acid sequence :
KAQAEVRAALKEKTNWDVDDVQELKYMKSVVKETMRMHPPIPLIPRSCREECVVNGYTIPNKARIMINVWSMGRNPLYWEKPDTFWPERFDQVSKDFMGNDFEFVPFGAGRXICPGLNFG LANVEVPLAHFFTTXTG
Physicochemical properties
Number of amino acids:		137
Molecular weight:		15,554.777
Theoretical pI:		6.927
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		26470 26595
Instability index:		24.456
aromaticity		0.119
GRAVY		-0.366
Secondary Structure Fraction
Helix		0.304
turn		0.230
sheet		0.230