| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AW256019.1 | internal | 157 | 471-1(-) |
Amino Acid sequence : | |||
| SKTLGKKWQKYCRAKNLVYTCFKLDVSHRWNSTYEMINSTIAYRGHICDFFRKEFTNIQLQLNESHWDACMDLYRLLKIFHMATKQLSGVYYCTSVMVLEHCMYVAMAFKSCFSKTTLTG CIYIMVKKWLKYFREIPTIFLVAKCLDPKWKYDGVCQ | |||
Physicochemical properties | |||
| Number of amino acids: | 157 | ||
| Molecular weight: | 18,735.003 | ||
| Theoretical pI: | 9.277 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 43890 44515 | ||
| Instability index: | 32.938 | ||
| aromaticity | 0.159 | ||
| GRAVY | -0.090 | ||
Secondary Structure Fraction | |||
| Helix | 0.363 | ||
| turn | 0.134 | ||
| sheet | 0.210 | ||