Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AW256027.1 | 3prime_partial | 137 | 71-481(+) |
Amino Acid sequence : | |||
MATNGVVISCLREVRPPMTKHAPSMWTDTFSNFSLDDKEQQKCSETIEALKQEARGMLMAATTPLQQMTLIDTLERLGLSFHFETEIEYKIELINAAEDDGFDLFATALRFRLLRQHQRH VSCDVFDKFIDKDGKFE | |||
Physicochemical properties | |||
Number of amino acids: | 137 | ||
Molecular weight: | 15,791.849 | ||
Theoretical pI: | 5.090 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
Instability index: | 46.980 | ||
aromaticity | 0.088 | ||
GRAVY | -0.356 | ||
Secondary Structure Fraction | |||
Helix | 0.277 | ||
turn | 0.139 | ||
sheet | 0.307 |