| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AX127287.1 | complete | 167 | 1-504(+) |
Amino Acid sequence : | |||
| MASQSATSVHDFTVKDAKGNDVDLSVYKGKVLLIVNVASKCGLTNSNYTELTQLYEKYKDQGFEILAFPCNQFGAEEPGSNEEIVEFACTRFKAEFPIFDKVDVNGDQAAPIYKFLKSSK GGLFGDSIKWNFSKFLVDKDGHVVDRYAPTTPPLSIEKDIKKLLGVS* | |||
Physicochemical properties | |||
| Number of amino acids: | 167 | ||
| Molecular weight: | 18,475.728 | ||
| Theoretical pI: | 5.433 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14565 | ||
| Instability index: | 22.978 | ||
| aromaticity | 0.114 | ||
| GRAVY | -0.271 | ||
Secondary Structure Fraction | |||
| Helix | 0.323 | ||
| turn | 0.240 | ||
| sheet | 0.210 | ||