Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AX127287.1 | complete | 167 | 1-504(+) |
Amino Acid sequence : | |||
MASQSATSVHDFTVKDAKGNDVDLSVYKGKVLLIVNVASKCGLTNSNYTELTQLYEKYKDQGFEILAFPCNQFGAEEPGSNEEIVEFACTRFKAEFPIFDKVDVNGDQAAPIYKFLKSSK GGLFGDSIKWNFSKFLVDKDGHVVDRYAPTTPPLSIEKDIKKLLGVS* | |||
Physicochemical properties | |||
Number of amino acids: | 167 | ||
Molecular weight: | 18,475.728 | ||
Theoretical pI: | 5.433 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14565 | ||
Instability index: | 22.978 | ||
aromaticity | 0.114 | ||
GRAVY | -0.271 | ||
Secondary Structure Fraction | |||
Helix | 0.323 | ||
turn | 0.240 | ||
sheet | 0.210 |