| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AX127289.1 | complete | 167 | 64-567(+) |
Amino Acid sequence : | |||
| MASQSATSVHDFTVKDARGNDVDLSIYKGKVLLIVNVASQCGLTNSNYTELSQLYKKYKDQGFEILAFPCNQFGAQEPGTNEQILEFACTRFKAEYPIFDKVDVNGDQAAPIYKFLKSSK GGFFGDGIKWNFSKFLVDKDGHVVDRYAPTTSPLSIEKDIKKLLGGS* | |||
Physicochemical properties | |||
| Number of amino acids: | 167 | ||
| Molecular weight: | 14,471.868 | ||
| Theoretical pI: | 5.629 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5750 | ||
| Instability index: | 50.105 | ||
| aromaticity | 0.055 | ||
| GRAVY | 0.386 | ||
Secondary Structure Fraction | |||
| Helix | 0.391 | ||
| turn | 0.164 | ||
| sheet | 0.297 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AX127289.1 | complete | 128 | 576-190(-) |
Amino Acid sequence : | |||
| MASLGTSQQLLDILLNTERRCSGCIAVHNMTILVNQELREVPLDAIPKETTFARFQELVDGCSLIPVHINLVKDGILSFEACTSKFQDLLIRSWFLSSKLVARESQDLETLILVLLVQLT QFCIIRIR* | |||
Physicochemical properties | |||
| Number of amino acids: | 128 | ||
| Molecular weight: | 14,471.868 | ||
| Theoretical pI: | 5.629 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5750 | ||
| Instability index: | 50.105 | ||
| aromaticity | 0.055 | ||
| GRAVY | 0.386 | ||
Secondary Structure Fraction | |||
| Helix | 0.391 | ||
| turn | 0.164 | ||
| sheet | 0.297 | ||