Acc_NO	ORF type	length	start-end position (strand +/-)
>AX127289.1	complete	167	64-567(+)
Amino Acid sequence :
MASQSATSVHDFTVKDARGNDVDLSIYKGKVLLIVNVASQCGLTNSNYTELSQLYKKYKDQGFEILAFPCNQFGAQEPGTNEQILEFACTRFKAEYPIFDKVDVNGDQAAPIYKFLKSSK GGFFGDGIKWNFSKFLVDKDGHVVDRYAPTTSPLSIEKDIKKLLGGS*
Physicochemical properties
Number of amino acids:		167
Molecular weight:		14,471.868
Theoretical pI:		5.629
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		5500 5750
Instability index:		50.105
aromaticity		0.055
GRAVY		0.386
Secondary Structure Fraction
Helix		0.391
turn		0.164
sheet		0.297

Acc_NO	ORF type	length	start-end position (strand +/-)
>AX127289.1	complete	128	576-190(-)
Amino Acid sequence :
MASLGTSQQLLDILLNTERRCSGCIAVHNMTILVNQELREVPLDAIPKETTFARFQELVDGCSLIPVHINLVKDGILSFEACTSKFQDLLIRSWFLSSKLVARESQDLETLILVLLVQLT QFCIIRIR*
Physicochemical properties
Number of amino acids:		128
Molecular weight:		14,471.868
Theoretical pI:		5.629
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		5500 5750
Instability index:		50.105
aromaticity		0.055
GRAVY		0.386
Secondary Structure Fraction
Helix		0.391
turn		0.164
sheet		0.297