Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AY179511.1 | internal | 165 | 1-495(+) |
Amino Acid sequence : | |||
SGYSLLRDPHHNKGLAFTDKERDAHYLRGLLPPVCISQELQEKKLMRSLRQYQVPLQRYMAMMDLQERNERLFYKLLIDNVEELLPVVYTPTVGEACQKYGCIFKRPQGLYISLKEKGKI LEVLKNWPERSIQAIVVTDGERILGLGDLGSQGMGIPVGKLSLYT | |||
Physicochemical properties | |||
Number of amino acids: | 165 | ||
Molecular weight: | 18,908.875 | ||
Theoretical pI: | 8.926 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18910 19035 | ||
Instability index: | 47.010 | ||
aromaticity | 0.079 | ||
GRAVY | -0.315 | ||
Secondary Structure Fraction | |||
Helix | 0.345 | ||
turn | 0.212 | ||
sheet | 0.285 |