Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AY332226.1 | internal | 160 | 1-480(+) |
Amino Acid sequence : | |||
DEYGNPIHNGSTGINTTGYQQQTAGLYGTGHGSGYGTGGTQFGTTQHTAGHGTGGTLTSTAPAGHGQTKLRRSGSGSSSSSEDDGQGGRRKKGLKEKIKEKLPGGHKDQHQPGQYKSVTT TIITPDSGYYEQSGQQHQQQHDKGIMDKIKDKLPGSFSLI | |||
Physicochemical properties | |||
Number of amino acids: | 160 | ||
Molecular weight: | 16,785.925 | ||
Theoretical pI: | 9.249 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 10430 10430 | ||
Instability index: | 28.114 | ||
aromaticity | 0.056 | ||
GRAVY | -1.155 | ||
Secondary Structure Fraction | |||
Helix | 0.156 | ||
turn | 0.350 | ||
sheet | 0.106 |