Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AY337458.1 | complete | 344 | 1-1035(+) |
Amino Acid sequence : | |||
MAPKEDSLALAEAWNHGFGFIKTSIVKTAVELGIPDILESRGAPVSIPELAAAVDCSADRLYRVMRFLAYHGIFKRTEPPPESTGGGSVYYAQTLVSRRLTRENLGPFVLLQGTMREPSG CVTAETLRMSKRPGLVDDNDSDRLYEDPVFSMKVFRDAMASHARMTTAAVIENYGEGFLGVGSLVDVGGSYGMALSMLVKAFPWLRGICFDLPEVVARASPLKGVEFVAGSMFESIPKAD VVMLMFVLHNWSDEECVEILKRCKDAVPKNKGKVIIIDAVIDEDGNGDEFTGARLGLDVTMMANMFEGRERTYVEWAHIINEAGFRRHVVKNIKTLESVIEAYP* | |||
Physicochemical properties | |||
Number of amino acids: | 344 | ||
Molecular weight: | 11,662.001 | ||
Theoretical pI: | 11.624 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22000 22125 | ||
Instability index: | 63.115 | ||
aromaticity | 0.080 | ||
GRAVY | -1.093 | ||
Secondary Structure Fraction | |||
Helix | 0.200 | ||
turn | 0.300 | ||
sheet | 0.190 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AY337458.1 | complete | 102 | 827-519(-) |
Amino Acid sequence : | |||
MITFPLFFGTASLHLFRISTHSSSLQLCNTNMSITTSAFGMLSNMLPATNSTPLRGDALATTSGRSKQIPRSQGKAFTNIERAIPYEPPTSTKDPTPRKPSP* | |||
Physicochemical properties | |||
Number of amino acids: | 102 | ||
Molecular weight: | 11,662.001 | ||
Theoretical pI: | 11.624 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22000 22125 | ||
Instability index: | 63.115 | ||
aromaticity | 0.080 | ||
GRAVY | -1.093 | ||
Secondary Structure Fraction | |||
Helix | 0.200 | ||
turn | 0.300 | ||
sheet | 0.190 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AY337458.1 | 5prime_partial | 100 | 3-305(+) |
Amino Acid sequence : | |||
GTERRFTSFGRSMEPWLRFHQNQHSQDCRRAWDTRHPRKPWSSGLDTGASRRCRLLCRPPIPSHEVPSLSWHLQENRAATRVDRGRFGLLRSNPGLAPPH* | |||
Physicochemical properties | |||
Number of amino acids: | 100 | ||
Molecular weight: | 11,662.001 | ||
Theoretical pI: | 11.624 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22000 22125 | ||
Instability index: | 63.115 | ||
aromaticity | 0.080 | ||
GRAVY | -1.093 | ||
Secondary Structure Fraction | |||
Helix | 0.200 | ||
turn | 0.300 | ||
sheet | 0.190 |