| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AY337458.1 | complete | 344 | 1-1035(+) |
Amino Acid sequence : | |||
| MAPKEDSLALAEAWNHGFGFIKTSIVKTAVELGIPDILESRGAPVSIPELAAAVDCSADRLYRVMRFLAYHGIFKRTEPPPESTGGGSVYYAQTLVSRRLTRENLGPFVLLQGTMREPSG CVTAETLRMSKRPGLVDDNDSDRLYEDPVFSMKVFRDAMASHARMTTAAVIENYGEGFLGVGSLVDVGGSYGMALSMLVKAFPWLRGICFDLPEVVARASPLKGVEFVAGSMFESIPKAD VVMLMFVLHNWSDEECVEILKRCKDAVPKNKGKVIIIDAVIDEDGNGDEFTGARLGLDVTMMANMFEGRERTYVEWAHIINEAGFRRHVVKNIKTLESVIEAYP* | |||
Physicochemical properties | |||
| Number of amino acids: | 344 | ||
| Molecular weight: | 11,662.001 | ||
| Theoretical pI: | 11.624 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22000 22125 | ||
| Instability index: | 63.115 | ||
| aromaticity | 0.080 | ||
| GRAVY | -1.093 | ||
Secondary Structure Fraction | |||
| Helix | 0.200 | ||
| turn | 0.300 | ||
| sheet | 0.190 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AY337458.1 | complete | 102 | 827-519(-) |
Amino Acid sequence : | |||
| MITFPLFFGTASLHLFRISTHSSSLQLCNTNMSITTSAFGMLSNMLPATNSTPLRGDALATTSGRSKQIPRSQGKAFTNIERAIPYEPPTSTKDPTPRKPSP* | |||
Physicochemical properties | |||
| Number of amino acids: | 102 | ||
| Molecular weight: | 11,662.001 | ||
| Theoretical pI: | 11.624 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22000 22125 | ||
| Instability index: | 63.115 | ||
| aromaticity | 0.080 | ||
| GRAVY | -1.093 | ||
Secondary Structure Fraction | |||
| Helix | 0.200 | ||
| turn | 0.300 | ||
| sheet | 0.190 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AY337458.1 | 5prime_partial | 100 | 3-305(+) |
Amino Acid sequence : | |||
| GTERRFTSFGRSMEPWLRFHQNQHSQDCRRAWDTRHPRKPWSSGLDTGASRRCRLLCRPPIPSHEVPSLSWHLQENRAATRVDRGRFGLLRSNPGLAPPH* | |||
Physicochemical properties | |||
| Number of amino acids: | 100 | ||
| Molecular weight: | 11,662.001 | ||
| Theoretical pI: | 11.624 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22000 22125 | ||
| Instability index: | 63.115 | ||
| aromaticity | 0.080 | ||
| GRAVY | -1.093 | ||
Secondary Structure Fraction | |||
| Helix | 0.200 | ||
| turn | 0.300 | ||
| sheet | 0.190 | ||