| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AY337461.1 | complete | 343 | 1-1032(+) |
Amino Acid sequence : | |||
| MVADEEVRVRAEAWNNAFGYIKPTAVATAVELGLPDILENHDGPMSLLELSAATDCPAEPLHRLMRFLVFHGIFKKTAKPPLSNEAVYYARTALSRLFTRDELGDFMLLQTGPLSQHPAG LTASSLRTGKPQFIRSVNGEDSWTDPVNGYHMKVFSDAMAAHARETTAAIVRYCPAAFEGIGTVVDVGGRHGVALEKLVAAFPWVRGISFDLPEIVAKAPPRPGIEFVGGSFFESVPKGD LVLLMWILHDWSDESCIEIMKKCKEAIPTSGKVMIVDAIVDEDGEGDDFAGARLSLDLIMMAVLARGKERTYREWEYLLREAGFTKFVVKNINTVEFVIEAYP* | |||
Physicochemical properties | |||
| Number of amino acids: | 343 | ||
| Molecular weight: | 17,869.068 | ||
| Theoretical pI: | 10.804 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 59.846 | ||
| aromaticity | 0.032 | ||
| GRAVY | -0.808 | ||
Secondary Structure Fraction | |||
| Helix | 0.248 | ||
| turn | 0.210 | ||
| sheet | 0.229 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AY337461.1 | complete | 157 | 573-100(-) |
Amino Acid sequence : | |||
| MAAADVHHRADPLECRRTVTDDRRRRLPGVRRHGIRKDLHMITVDRVSPRVLSVDRPDELGLPGSQRTGGQTGRVLRQRAGLEQHEIPQLIPREETRERRPSVVNGFVRERWFSGFLEDA MEYQKPHKPVERLSGAVGGGGELQQRHGAVVVLQDVR* | |||
Physicochemical properties | |||
| Number of amino acids: | 157 | ||
| Molecular weight: | 17,869.068 | ||
| Theoretical pI: | 10.804 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 59.846 | ||
| aromaticity | 0.032 | ||
| GRAVY | -0.808 | ||
Secondary Structure Fraction | |||
| Helix | 0.248 | ||
| turn | 0.210 | ||
| sheet | 0.229 | ||