Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AY337462.1 | complete | 361 | 1-1086(+) |
Amino Acid sequence : | |||
MALPNLEESTVEELLDAEAHVWNHIFSYINSMSLKSALQLGIPDIIHKHGNPITLSQLADALNINKAKTDGLFRLMRLLEHSKFFDKVKVEGEGEEEAYSLTRASRLLLRDEPSSLAPYI RAMLDPNFMDPFHHLSEWLGSECPSPFEFKHGRSLWEYAGIEERWNQLFNQAMANDAKLVTSILVKECRHIFQGLESLVDVGGGAGTVAKVVADAFPGLKAVVLDLPHVVADLATSENLR YVSGDMFEDIPRADAVLLKWILHNWSDEECIKILEKCKEAITPSKNNNGGKVIVIDMILKDEKQHHKGTETQLLFDVLMMTALTGKERTEKEWANLFFAAGFKTYKIHPVLRLRSVIEIF P* | |||
Physicochemical properties | |||
Number of amino acids: | 361 | ||
Molecular weight: | 14,371.598 | ||
Theoretical pI: | 9.475 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15930 16180 | ||
Instability index: | 40.088 | ||
aromaticity | 0.164 | ||
GRAVY | 0.040 | ||
Secondary Structure Fraction | |||
Helix | 0.393 | ||
turn | 0.197 | ||
sheet | 0.164 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AY337462.1 | complete | 122 | 918-550(-) |
Amino Acid sequence : | |||
MVLLFILQYHINNNHFSAIVILAWSYGFFAFLQYFNTFFVTPIVQYPLKENCIGTRNVLKHISTDIPQILRRCQVSNNMRKIKYDGFQARKGICYDFGHRPCASAHVHQTLQPLKDMSTF FY* | |||
Physicochemical properties | |||
Number of amino acids: | 122 | ||
Molecular weight: | 14,371.598 | ||
Theoretical pI: | 9.475 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15930 16180 | ||
Instability index: | 40.088 | ||
aromaticity | 0.164 | ||
GRAVY | 0.040 | ||
Secondary Structure Fraction | |||
Helix | 0.393 | ||
turn | 0.197 | ||
sheet | 0.164 |