Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AY337929.1 | 5prime_partial | 279 | 2-841(+) |
Amino Acid sequence : | |||
AHHNPNLWFFFLLSIFGASERERERERERERDQSDMGRGRVELKRIENTINRQVTFSKRRGGLLKKANEISVLCDADVAIIIFSTKGKLSEYSTDARMESILERYDRYSCAERDIVAPDP DSQESWRDEYGRLKAKLEALQTSQRHLMGAQLDMLSAKELQQLEQQLENALKNIRSRKNQLLFDSISELLKKEKTLTTQNKDMEMKLIEKKKVKSMARQGQQYTESSSPPSLLIQDPFPS LTIGINPASGSSEEDNEARLLPPVNRNRLPPWMVRSANE* | |||
Physicochemical properties | |||
Number of amino acids: | 279 | ||
Molecular weight: | 12,430.381 | ||
Theoretical pI: | 7.486 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19980 | ||
Instability index: | 68.559 | ||
aromaticity | 0.171 | ||
GRAVY | 0.657 | ||
Secondary Structure Fraction | |||
Helix | 0.351 | ||
turn | 0.315 | ||
sheet | 0.279 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AY337929.1 | complete | 111 | 648-313(-) |
Amino Acid sequence : | |||
MLFTFFFSMSFISMSLFWVVRVFSFFRSSDMESNSNWFFLDLIFFKAFSSCCSSCCSSLALSMSSCAPMRCLWLVCKASSLALSLPYSSLQLSCESGSGATMSLSAQEYRS* | |||
Physicochemical properties | |||
Number of amino acids: | 111 | ||
Molecular weight: | 12,430.381 | ||
Theoretical pI: | 7.486 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19980 | ||
Instability index: | 68.559 | ||
aromaticity | 0.171 | ||
GRAVY | 0.657 | ||
Secondary Structure Fraction | |||
Helix | 0.351 | ||
turn | 0.315 | ||
sheet | 0.279 |