Acc_NO	ORF type	length	start-end position (strand +/-)
>AY422686.1	complete	152	28-486(+)
Amino Acid sequence :
MAVHKEVSSLAYLLVLGLLFLFVSAIKHVDAKPCTRECGNLGYGICPRSEGSPENPICTNCCSGYKGCNYYSANGTFICEGSSDPKNPNTCPLYCDGDIAYSKCPRSEGQTIIYPTGCTT CCTGYKGCYYFSKEGEFVCEGESIEPNVISNQ*
Physicochemical properties
Number of amino acids:		152
Molecular weight:		16,432.483
Theoretical pI:		5.124
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		16390 17390
Instability index:		38.130
aromaticity		0.105
GRAVY		-0.168
Secondary Structure Fraction
Helix		0.270
turn		0.322
sheet		0.178