Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AY555579.1 | complete | 226 | 214-894(+) |
Amino Acid sequence : | |||
MGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSTRGRLYEYANNSVKGTIDRYKKACTDTSNSGTVSEANSQYYQQEASKLLQQIAQLQNSNRNLMGESLSTMS PRELRQLEGKLEKGINKIRAKKNELLYAEIEYMQKREMELQNDNMYLRNKISENERAQQHMNMLPSATATEYEAMPPFDSRSFLQANLVDPNHHYSHQQQTALQLG* | |||
Physicochemical properties | |||
Number of amino acids: | 226 | ||
Molecular weight: | 11,634.751 | ||
Theoretical pI: | 4.437 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 12085 | ||
Instability index: | 57.887 | ||
aromaticity | 0.162 | ||
GRAVY | 1.096 | ||
Secondary Structure Fraction | |||
Helix | 0.400 | ||
turn | 0.286 | ||
sheet | 0.295 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AY555579.1 | complete | 105 | 797-480(-) |
Amino Acid sequence : | |||
MASYSVAVADGNMFMCCCALSFSDILFLRYILSFCSSISLFCMYSISAYNNSFFLALILLMPFSSFPSSCLSSLGLMVLSDSPIKFLFEFCNCAICCRSLEASCW* | |||
Physicochemical properties | |||
Number of amino acids: | 105 | ||
Molecular weight: | 11,634.751 | ||
Theoretical pI: | 4.437 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 12085 | ||
Instability index: | 57.887 | ||
aromaticity | 0.162 | ||
GRAVY | 1.096 | ||
Secondary Structure Fraction | |||
Helix | 0.400 | ||
turn | 0.286 | ||
sheet | 0.295 |