| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AY641428.1 | complete | 265 | 1-798(+) |
Amino Acid sequence : | |||
| MASVKKLAGKVAIVTGGASGIGEVTARLFAERGARAVVIADMQPEKGGTVAESIGGRRCSYVHCDITDEQQVRSVVDWTAATYGGVDVMFCNAGTASATAQTVLDLDLAQFDRVMRVNAR GTAACVKQAARKMVELGRGGAIICTASATVHHAGPNLTDYIMSKCGVLGLVRSASLQLGVHGIRVNSVSPTALATPLTATIGLRTAADVESFYGQVTSLKGVAITAEHVAEAVAFLASDE AAFVTGHDLAVDGGLQCLPFVAVAK* | |||
Physicochemical properties | |||
| Number of amino acids: | 265 | ||
| Molecular weight: | 15,639.534 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 125.062 | ||
| aromaticity | 0.015 | ||
| GRAVY | -2.035 | ||
Secondary Structure Fraction | |||
| Helix | 0.108 | ||
| turn | 0.231 | ||
| sheet | 0.154 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AY641428.1 | 3prime_partial | 247 | 741-1(-) |
Amino Acid sequence : | |||
| MAGDERRLIRSQKCHRLRHVLRRDRHPFQARDLPIEALHIGGRPEPDRRGERRGQRRRRHAVNPNPVHPELQTRRPHQPQHPALRHDVVRQVGPGVVHRRAGGADDSAAPPQLHHLTRRL LHARRRATGVDTHHAVELRQVQVQDGLSGGAGGAGVAEHHVDAAVGGGGPIHDGPDLLLVGDVAVDVAAPPAAYGFRHGTALLGLHVGDHHCAGAALGEEAGGDLADAAGAAGYDGYLAC ELLHACH | |||
Physicochemical properties | |||
| Number of amino acids: | 247 | ||
| Molecular weight: | 15,639.534 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 125.062 | ||
| aromaticity | 0.015 | ||
| GRAVY | -2.035 | ||
Secondary Structure Fraction | |||
| Helix | 0.108 | ||
| turn | 0.231 | ||
| sheet | 0.154 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AY641428.1 | 5prime_partial | 130 | 3-395(+) |
Amino Acid sequence : | |||
| GKREEARRQGSHRNRRRQRHRRGHRPPLRRARRPRSGDRRHAAREGRYRGGIHRRPAVQLRPLRHHRRATGQVRRGLDRRHLRRRRRDVLQRRHRQRHRSDRPGPGPGAVRPRDACQRPW HGGVREAGGA* | |||
Physicochemical properties | |||
| Number of amino acids: | 130 | ||
| Molecular weight: | 15,639.534 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 125.062 | ||
| aromaticity | 0.015 | ||
| GRAVY | -2.035 | ||
Secondary Structure Fraction | |||
| Helix | 0.108 | ||
| turn | 0.231 | ||
| sheet | 0.154 | ||