Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AY923864.1 | complete | 168 | 1-507(+) |
Amino Acid sequence : | |||
MGKCQAVFLLVGALCVLSLAGVANAAENHFKVQGMVYCDTCRIQFMTRVSTIMEGATVKLECRNITAGTQTFKAEAVTDKVGQYSIPVHGDFQDDICEIELVKSPNSECSEVSHDVYAKQ SAKVSLTSNNGEASDIRSANALGFMRKEPLKECPEVLKELDLYDVKAN* | |||
Physicochemical properties | |||
Number of amino acids: | 168 | ||
Molecular weight: | 18,288.744 | ||
Theoretical pI: | 5.223 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6460 | ||
Instability index: | 29.532 | ||
aromaticity | 0.060 | ||
GRAVY | -0.074 | ||
Secondary Structure Fraction | |||
Helix | 0.280 | ||
turn | 0.202 | ||
sheet | 0.280 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AY923864.1 | complete | 168 | 1-507(+) |
Amino Acid sequence : | |||
MGKCQAVFLLVGALCVLSLAGVANAAENHFKVQGMVYCDTCRIQFMTRVSTIMEGATVKLECRNITAGTQTFKAEAVTDKVGQYSIPVHGDFQDDICEIELVKSPNSECSEVSHDVYAKQ SAKVSLTSNNGEASDIRSANALGFMRKEPLKECPEVLKELDLYDVKAN* | |||
Physicochemical properties | |||
Number of amino acids: | 168 | ||
Molecular weight: | 18,288.744 | ||
Theoretical pI: | 5.223 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6460 | ||
Instability index: | 29.532 | ||
aromaticity | 0.060 | ||
GRAVY | -0.074 | ||
Secondary Structure Fraction | |||
Helix | 0.280 | ||
turn | 0.202 | ||
sheet | 0.280 |