Acc_NO	ORF type	length	start-end position (strand +/-)
>AY936689.1	complete	110	652-320(-)
Amino Acid sequence :
MNKAVFRVFSTTECHGTNRPGLMFGPTTISEVYGKPFSAPNSRAPQEGSEGATLRDTQADVPSTRRLWAQLAFKDSMVHGILQFTPSIAFRYVLHRCESRDIRCRESFWL*
Physicochemical properties
Number of amino acids:		110
Molecular weight:		12,469.041
Theoretical pI:		9.348
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		13980 14105
Instability index:		48.324
aromaticity		0.109
GRAVY		-0.393
Secondary Structure Fraction
Helix		0.264
turn		0.245
sheet		0.218