| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AY948339.1 | complete | 217 | 95-748(+) |
Amino Acid sequence : | |||
| MGRGRIEIRKIENATNRQVTYSKRRLGIMKKAKELTVLCDAEVSIIMLSSTGKFAEYCSPTTDLKKVVDRYQQVSGIDVWKDQYERMQTTLRHLEGINHKLRREIRQKMGEDLDGLGIKE LRGLEQSLDESLRLVRQRKYHVIATQTETYKKKLKSTHEAHRSLVHELEMKGEHPDYGFSMEDTFAMANGGPHMFAFGGHPNRHDILGHDSHDLSLA* | |||
Physicochemical properties | |||
| Number of amino acids: | 217 | ||
| Molecular weight: | 12,427.537 | ||
| Theoretical pI: | 6.155 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 21095 | ||
| Instability index: | 48.504 | ||
| aromaticity | 0.080 | ||
| GRAVY | -0.643 | ||
Secondary Structure Fraction | |||
| Helix | 0.223 | ||
| turn | 0.313 | ||
| sheet | 0.205 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AY948339.1 | complete | 163 | 568-77(-) |
Amino Acid sequence : | |||
| MGALQLLLIGFRLCGNHMILPLPNKPQRLIQTLLKTAQFLYPQAIQIFPHFLPDFPAEFVVDPLQVPQSRLHSLVLVLPHVDAGNLLVTIDNLLEVGGRAAVLSELSGAGEHDNRNLGIA EDGELLGLLHDAQPPLGVGHLTVGRILYLPYLNPSSPHFSIQQ* | |||
Physicochemical properties | |||
| Number of amino acids: | 163 | ||
| Molecular weight: | 12,427.537 | ||
| Theoretical pI: | 6.155 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 21095 | ||
| Instability index: | 48.504 | ||
| aromaticity | 0.080 | ||
| GRAVY | -0.643 | ||
Secondary Structure Fraction | |||
| Helix | 0.223 | ||
| turn | 0.313 | ||
| sheet | 0.205 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AY948339.1 | complete | 112 | 746-408(-) |
Amino Acid sequence : | |||
| MQDSDHGSHVREYRAGSDDLRKQTCEVLHWPWQMYLPLKIHNPDAHLSSPVHALSSCVLHGCSSASSYRFPSVWQSHDTSSAEQASTTHPNFAQDRAVPLSPGHPDLPPFSA* | |||
Physicochemical properties | |||
| Number of amino acids: | 112 | ||
| Molecular weight: | 12,427.537 | ||
| Theoretical pI: | 6.155 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 21095 | ||
| Instability index: | 48.504 | ||
| aromaticity | 0.080 | ||
| GRAVY | -0.643 | ||
Secondary Structure Fraction | |||
| Helix | 0.223 | ||
| turn | 0.313 | ||
| sheet | 0.205 | ||