Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AY948339.1 | complete | 217 | 95-748(+) |
Amino Acid sequence : | |||
MGRGRIEIRKIENATNRQVTYSKRRLGIMKKAKELTVLCDAEVSIIMLSSTGKFAEYCSPTTDLKKVVDRYQQVSGIDVWKDQYERMQTTLRHLEGINHKLRREIRQKMGEDLDGLGIKE LRGLEQSLDESLRLVRQRKYHVIATQTETYKKKLKSTHEAHRSLVHELEMKGEHPDYGFSMEDTFAMANGGPHMFAFGGHPNRHDILGHDSHDLSLA* | |||
Physicochemical properties | |||
Number of amino acids: | 217 | ||
Molecular weight: | 12,427.537 | ||
Theoretical pI: | 6.155 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 21095 | ||
Instability index: | 48.504 | ||
aromaticity | 0.080 | ||
GRAVY | -0.643 | ||
Secondary Structure Fraction | |||
Helix | 0.223 | ||
turn | 0.313 | ||
sheet | 0.205 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AY948339.1 | complete | 163 | 568-77(-) |
Amino Acid sequence : | |||
MGALQLLLIGFRLCGNHMILPLPNKPQRLIQTLLKTAQFLYPQAIQIFPHFLPDFPAEFVVDPLQVPQSRLHSLVLVLPHVDAGNLLVTIDNLLEVGGRAAVLSELSGAGEHDNRNLGIA EDGELLGLLHDAQPPLGVGHLTVGRILYLPYLNPSSPHFSIQQ* | |||
Physicochemical properties | |||
Number of amino acids: | 163 | ||
Molecular weight: | 12,427.537 | ||
Theoretical pI: | 6.155 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 21095 | ||
Instability index: | 48.504 | ||
aromaticity | 0.080 | ||
GRAVY | -0.643 | ||
Secondary Structure Fraction | |||
Helix | 0.223 | ||
turn | 0.313 | ||
sheet | 0.205 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AY948339.1 | complete | 112 | 746-408(-) |
Amino Acid sequence : | |||
MQDSDHGSHVREYRAGSDDLRKQTCEVLHWPWQMYLPLKIHNPDAHLSSPVHALSSCVLHGCSSASSYRFPSVWQSHDTSSAEQASTTHPNFAQDRAVPLSPGHPDLPPFSA* | |||
Physicochemical properties | |||
Number of amino acids: | 112 | ||
Molecular weight: | 12,427.537 | ||
Theoretical pI: | 6.155 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 21095 | ||
Instability index: | 48.504 | ||
aromaticity | 0.080 | ||
GRAVY | -0.643 | ||
Secondary Structure Fraction | |||
Helix | 0.223 | ||
turn | 0.313 | ||
sheet | 0.205 |