Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AY948340.1 | complete | 217 | 59-712(+) |
Amino Acid sequence : | |||
MGRGRIEIRKIENATNRQVTYSKRRLGIMKKAKELTVLCDAEVSIIMLSSTGKFAEYCSPTTDLKKVVDRYQQVSGIDLWKDQYERMQTTLRHLEGINHKLRREIRQKMGEDLDGLGIKE LRGLEQSLDESLRLVRQRKYHVIATQTETYKKKLKSTHEAHRSLVHELEMKGEHPDYGFSMEDTFAMANGGPHMFAFGGHPNRHDILGHDSHDLSLA* | |||
Physicochemical properties | |||
Number of amino acids: | 217 | ||
Molecular weight: | 12,367.507 | ||
Theoretical pI: | 6.155 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19730 | ||
Instability index: | 52.396 | ||
aromaticity | 0.071 | ||
GRAVY | -0.609 | ||
Secondary Structure Fraction | |||
Helix | 0.214 | ||
turn | 0.313 | ||
sheet | 0.205 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AY948340.1 | complete | 163 | 532-41(-) |
Amino Acid sequence : | |||
MGALQLLLVGFRLCGNHMILPLPNEPQRLIQTLLKTAQFLYPQAIQIFPHFLPDFPTEFVVDPLQVPQSRLHSLVLVLPQVDAGNLLVTIDNLLEVSGRAAVLSELSGAGEHDNRNLGIA EDGELLGLLHDAQPPLGVGHLTVGRILYLPYLNPSSPHFSIQQ* | |||
Physicochemical properties | |||
Number of amino acids: | 163 | ||
Molecular weight: | 12,367.507 | ||
Theoretical pI: | 6.155 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19730 | ||
Instability index: | 52.396 | ||
aromaticity | 0.071 | ||
GRAVY | -0.609 | ||
Secondary Structure Fraction | |||
Helix | 0.214 | ||
turn | 0.313 | ||
sheet | 0.205 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AY948340.1 | complete | 112 | 710-372(-) |
Amino Acid sequence : | |||
MQDSDHGSHVREYRAGSDDLQKQTCEVLHWPWQMYLPLKIHNPDAHLSSPVHALSSCVLHGCSSASSCRFPSVWQSHDTSSAERASTTHPNFAQDRAVPLSPGHPDLPPFSA* | |||
Physicochemical properties | |||
Number of amino acids: | 112 | ||
Molecular weight: | 12,367.507 | ||
Theoretical pI: | 6.155 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19730 | ||
Instability index: | 52.396 | ||
aromaticity | 0.071 | ||
GRAVY | -0.609 | ||
Secondary Structure Fraction | |||
Helix | 0.214 | ||
turn | 0.313 | ||
sheet | 0.205 |