| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AY948340.1 | complete | 217 | 59-712(+) |
Amino Acid sequence : | |||
| MGRGRIEIRKIENATNRQVTYSKRRLGIMKKAKELTVLCDAEVSIIMLSSTGKFAEYCSPTTDLKKVVDRYQQVSGIDLWKDQYERMQTTLRHLEGINHKLRREIRQKMGEDLDGLGIKE LRGLEQSLDESLRLVRQRKYHVIATQTETYKKKLKSTHEAHRSLVHELEMKGEHPDYGFSMEDTFAMANGGPHMFAFGGHPNRHDILGHDSHDLSLA* | |||
Physicochemical properties | |||
| Number of amino acids: | 217 | ||
| Molecular weight: | 12,367.507 | ||
| Theoretical pI: | 6.155 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19730 | ||
| Instability index: | 52.396 | ||
| aromaticity | 0.071 | ||
| GRAVY | -0.609 | ||
Secondary Structure Fraction | |||
| Helix | 0.214 | ||
| turn | 0.313 | ||
| sheet | 0.205 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AY948340.1 | complete | 163 | 532-41(-) |
Amino Acid sequence : | |||
| MGALQLLLVGFRLCGNHMILPLPNEPQRLIQTLLKTAQFLYPQAIQIFPHFLPDFPTEFVVDPLQVPQSRLHSLVLVLPQVDAGNLLVTIDNLLEVSGRAAVLSELSGAGEHDNRNLGIA EDGELLGLLHDAQPPLGVGHLTVGRILYLPYLNPSSPHFSIQQ* | |||
Physicochemical properties | |||
| Number of amino acids: | 163 | ||
| Molecular weight: | 12,367.507 | ||
| Theoretical pI: | 6.155 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19730 | ||
| Instability index: | 52.396 | ||
| aromaticity | 0.071 | ||
| GRAVY | -0.609 | ||
Secondary Structure Fraction | |||
| Helix | 0.214 | ||
| turn | 0.313 | ||
| sheet | 0.205 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AY948340.1 | complete | 112 | 710-372(-) |
Amino Acid sequence : | |||
| MQDSDHGSHVREYRAGSDDLQKQTCEVLHWPWQMYLPLKIHNPDAHLSSPVHALSSCVLHGCSSASSCRFPSVWQSHDTSSAERASTTHPNFAQDRAVPLSPGHPDLPPFSA* | |||
Physicochemical properties | |||
| Number of amino acids: | 112 | ||
| Molecular weight: | 12,367.507 | ||
| Theoretical pI: | 6.155 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19730 | ||
| Instability index: | 52.396 | ||
| aromaticity | 0.071 | ||
| GRAVY | -0.609 | ||
Secondary Structure Fraction | |||
| Helix | 0.214 | ||
| turn | 0.313 | ||
| sheet | 0.205 | ||