Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AY959235.1 | 5prime_partial | 137 | 1-414(+) |
Amino Acid sequence : | |||
SGTFRLCVDYRQLNKVTIKNRYPLPRIDDLFDQMKGATVFSKIDLKSGYHQLRIAETDIHKTAFHTRYGHYEFTVVPFGLTNAPAVFMSLMNGVFKTFLDRFMLTFLDDLLIFSGSQLSS LXIPXTSPRITIHTEQV* | |||
Physicochemical properties | |||
Number of amino acids: | 137 | ||
Molecular weight: | 15,524.784 | ||
Theoretical pI: | 9.130 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7450 | ||
Instability index: | 28.411 | ||
aromaticity | 0.126 | ||
GRAVY | -0.031 | ||
Secondary Structure Fraction | |||
Helix | 0.363 | ||
turn | 0.193 | ||
sheet | 0.200 |