Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>AY959236.1 | internal | 115 | 3-347(+) |
Amino Acid sequence : | |||
SGTFRLCIDYRALNKKTIKNRYPFPRIDELLDELHGAIYFSKIDLRSGYHQIRVREEDILKTTFRCHYGHYEFLVMPFGLTNAPATFQSCMNHLFNKQVRKFVLVFFDDLLIFSG | |||
Physicochemical properties | |||
Number of amino acids: | 115 | ||
Molecular weight: | 13,658.672 | ||
Theoretical pI: | 9.073 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8940 9065 | ||
Instability index: | 54.897 | ||
aromaticity | 0.157 | ||
GRAVY | -0.175 | ||
Secondary Structure Fraction | |||
Helix | 0.383 | ||
turn | 0.174 | ||
sheet | 0.209 |