| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AY995182.1 | 5prime_partial | 552 | 3-1661(+) |
Amino Acid sequence : | |||
| HEAPFPHSPSPFPVLFSALSPTTMVDLGLSGSVLAVVLGFVAVFWFFIQGNGGGSKDKTDDPATTTTTTTTVYDGESRSKDGNDDVDIIIVGAGVAGAALAHTLGKEGRRVKVIERDLTE PDRIVGELLQPGGYLKLQELGLEDCVEKIDAQRVFGYALFKDGKSTRLSYPLEKFHSDVAGRSFHNGRFIQRMREKAASLPNVKLEQGTVTSLLEENGTIKGVQYKTKSGEELKAYAPLT VVCDGCFSNLRRTLCDPKVEVPSCFVGLVLENCQLPHENHGHVILADPSPILFYPISSTEVRCLVDVPGQKVPSISNGEMAKYLKNVVAPQVPAEIKDAFIAAINKGNIRTMPNRSMPAA PHPTPGALLMGDAFNMRHPLTGGGMTVALSDIVVLRDLLKPLHDLNDAPTLCRYLESFYTLRKPVASTINTLAGALYKVFCASPDQARKEMREACFDYLSLGGVFSEGPVSLLSGLNPRP LSLVCHFFAVAIYGVGRLLLPFPSPKRLWIGARLISGASAIIFPIIKAEGVRQMFFPATIPAYYRAPPEVRL* | |||
Physicochemical properties | |||
| Number of amino acids: | 552 | ||
| Molecular weight: | 13,010.387 | ||
| Theoretical pI: | 11.541 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27500 27625 | ||
| Instability index: | 65.317 | ||
| aromaticity | 0.117 | ||
| GRAVY | 0.021 | ||
Secondary Structure Fraction | |||
| Helix | 0.351 | ||
| turn | 0.234 | ||
| sheet | 0.252 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AY995182.1 | complete | 114 | 1211-867(-) |
Amino Acid sequence : | |||
| MKRFEKITQYNNIRQCYSHSSTSQGVAHIKSISHEKSTRSWMRSSWHASVWHCPDVPFINCGNECIFYLSRYLGSNYVFQIFGHFTIRNRRHFLTRYINQTANLSTAYGIEQDR* | |||
Physicochemical properties | |||
| Number of amino acids: | 114 | ||
| Molecular weight: | 13,010.387 | ||
| Theoretical pI: | 11.541 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27500 27625 | ||
| Instability index: | 65.317 | ||
| aromaticity | 0.117 | ||
| GRAVY | 0.021 | ||
Secondary Structure Fraction | |||
| Helix | 0.351 | ||
| turn | 0.234 | ||
| sheet | 0.252 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >AY995182.1 | 5prime_partial | 111 | 1-336(+) |
Amino Acid sequence : | |||
| GTRRHFLILRRRFPSFFLHCRLRQWWIWVSPDLFLPWCWGSLQFSGFSFREMVAAAKIKLMTLPPPPPPQLRCMMENPDQRMETTTLTSSSLVQVLPVPLSRTLLARKGVV* | |||
Physicochemical properties | |||
| Number of amino acids: | 111 | ||
| Molecular weight: | 13,010.387 | ||
| Theoretical pI: | 11.541 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27500 27625 | ||
| Instability index: | 65.317 | ||
| aromaticity | 0.117 | ||
| GRAVY | 0.021 | ||
Secondary Structure Fraction | |||
| Helix | 0.351 | ||
| turn | 0.234 | ||
| sheet | 0.252 | ||