Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>BD081616.1 | complete | 311 | 1-936(+) |
Amino Acid sequence : | |||
MAINLSHINSKTSFPLKTRSDLSRSSSARCMPTAAAAVFPTIATAAQSQPYWAAIVADIDRYLKKSIPIRPPETVFGPMHHLTFAAPATAASASALCLAACELVGGDRSQAMAAAAAIHL MHAAAYVHEHLPLTDGSRKPAIQHKYGPNVELLTGDGIVPFGFELLAGSVDPARRDDPDRILRVIIEISRAGGSEGIISGLHREEEIVDGNTSFDFIEYVCKKKYGEMHACGAACGAILG GAAEEEIQKLRNFGLYQGTLRGMMEMKNSHEIDDNIIRKLKELALEELGGFHGKQAELMSSLVAGPSPCAA* | |||
Physicochemical properties | |||
Number of amino acids: | 311 | ||
Molecular weight: | 11,932.653 | ||
Theoretical pI: | 9.433 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15720 | ||
Instability index: | 61.835 | ||
aromaticity | 0.089 | ||
GRAVY | 0.175 | ||
Secondary Structure Fraction | |||
Helix | 0.295 | ||
turn | 0.393 | ||
sheet | 0.179 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>BD081616.1 | 5prime_partial | 179 | 936-397(-) |
Amino Acid sequence : | |||
LSRTRARPGYKAGHQLSLLSVEASQLLESQFFQFSNYIIINFMRIFHFHHSSESSLIKPEIPQLLNLLLGCAAQYGSTSRAASMHLAVFFLTHIFNEVETRISINNFFFPMQPAYYSLRP AGPTDLYYNPQNSIRVVSSGRVHRPGQQLKPERNNPISGEELDVRAVLVLDCGLPRPVG* | |||
Physicochemical properties | |||
Number of amino acids: | 179 | ||
Molecular weight: | 11,932.653 | ||
Theoretical pI: | 9.433 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15720 | ||
Instability index: | 61.835 | ||
aromaticity | 0.089 | ||
GRAVY | 0.175 | ||
Secondary Structure Fraction | |||
Helix | 0.295 | ||
turn | 0.393 | ||
sheet | 0.179 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>BD081616.1 | complete | 112 | 713-375(-) |
Amino Acid sequence : | |||
MAPQAAPQACISPYFFLHTYSMKSKLVFPSTISSSLCSPLIIPSDPPARLISIITLRILSGSSLRAGSTDPASNSNPNGTIPSPVRSSTFGPYLCWIAGFLDPSVRGRCSWT* | |||
Physicochemical properties | |||
Number of amino acids: | 112 | ||
Molecular weight: | 11,932.653 | ||
Theoretical pI: | 9.433 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15720 | ||
Instability index: | 61.835 | ||
aromaticity | 0.089 | ||
GRAVY | 0.175 | ||
Secondary Structure Fraction | |||
Helix | 0.295 | ||
turn | 0.393 | ||
sheet | 0.179 |