| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >BM005534.1 | internal | 160 | 480-1(-) |
Amino Acid sequence : | |||
| YAWAFCLKRKSDVLNTFKRWKAMVETRTGKKVKALRSDDTVDTDGALKDFCEREDIVHHWSVGHTPQQGGVAERLNRTLREKAMCMRSYAGMGHEWWAESINTALYIVNRSPHRSLGGET PTSYGRVTMRIMVDLESRMHGYYHDSEGKLGARRRSIFAV | |||
Physicochemical properties | |||
| Number of amino acids: | 160 | ||
| Molecular weight: | 18,424.796 | ||
| Theoretical pI: | 9.599 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 36440 36565 | ||
| Instability index: | 47.005 | ||
| aromaticity | 0.094 | ||
| GRAVY | -0.649 | ||
Secondary Structure Fraction | |||
| Helix | 0.256 | ||
| turn | 0.194 | ||
| sheet | 0.244 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >BM005534.1 | internal | 160 | 480-1(-) |
Amino Acid sequence : | |||
| YAWAFCLKRKSDVLNTFKRWKAMVETRTGKKVKALRSDDTVDTDGALKDFCEREDIVHHWSVGHTPQQGGVAERLNRTLREKAMCMRSYAGMGHEWWAESINTALYIVNRSPHRSLGGET PTSYGRVTMRIMVDLESRMHGYYHDSEGKLGARRRSIFAV | |||
Physicochemical properties | |||
| Number of amino acids: | 160 | ||
| Molecular weight: | 18,424.796 | ||
| Theoretical pI: | 9.599 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 36440 36565 | ||
| Instability index: | 47.005 | ||
| aromaticity | 0.094 | ||
| GRAVY | -0.649 | ||
Secondary Structure Fraction | |||
| Helix | 0.256 | ||
| turn | 0.194 | ||
| sheet | 0.244 | ||