| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >BM005538.1 | internal | 149 | 447-1(-) |
Amino Acid sequence : | |||
| HGSEYLFITSTQYCQNRILAKLKCLSSGLYLATIQHLESNLIIRRQPIDEIIFMLWHDRLGHPGQNTMLRTMNASHGHPLGGKNFVVNPKSQCQACSIGKTNLKPLHVKPTRLVSQFLER IHEDICGPIQPTCGPFKYFMVLVDASTRW | |||
Physicochemical properties | |||
| Number of amino acids: | 149 | ||
| Molecular weight: | 16,956.595 | ||
| Theoretical pI: | 9.302 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 17335 | ||
| Instability index: | 29.329 | ||
| aromaticity | 0.081 | ||
| GRAVY | -0.187 | ||
Secondary Structure Fraction | |||
| Helix | 0.315 | ||
| turn | 0.242 | ||
| sheet | 0.208 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >BM005538.1 | internal | 149 | 447-1(-) |
Amino Acid sequence : | |||
| HGSEYLFITSTQYCQNRILAKLKCLSSGLYLATIQHLESNLIIRRQPIDEIIFMLWHDRLGHPGQNTMLRTMNASHGHPLGGKNFVVNPKSQCQACSIGKTNLKPLHVKPTRLVSQFLER IHEDICGPIQPTCGPFKYFMVLVDASTRW | |||
Physicochemical properties | |||
| Number of amino acids: | 149 | ||
| Molecular weight: | 16,956.595 | ||
| Theoretical pI: | 9.302 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 17335 | ||
| Instability index: | 29.329 | ||
| aromaticity | 0.081 | ||
| GRAVY | -0.187 | ||
Secondary Structure Fraction | |||
| Helix | 0.315 | ||
| turn | 0.242 | ||
| sheet | 0.208 | ||