Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>BM005568.1 | 5prime_partial | 116 | 1-351(+) |
Amino Acid sequence : | |||
LGKSARTAHWRPKMEQFAGVLRTASKETWKKKEMQFCILKKENASMTQKHLSTFIRKEMFRMPAVTGVLVFTSTPDKESNKYYLGPAPIEEWQANCYCNWALRKYREYLFLLEKAC* | |||
Physicochemical properties | |||
Number of amino acids: | 116 | ||
Molecular weight: | 13,690.889 | ||
Theoretical pI: | 9.635 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 29450 29700 | ||
Instability index: | 31.385 | ||
aromaticity | 0.129 | ||
GRAVY | -0.573 | ||
Secondary Structure Fraction | |||
Helix | 0.276 | ||
turn | 0.164 | ||
sheet | 0.302 |