| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >BM005568.1 | 5prime_partial | 116 | 1-351(+) |
Amino Acid sequence : | |||
| LGKSARTAHWRPKMEQFAGVLRTASKETWKKKEMQFCILKKENASMTQKHLSTFIRKEMFRMPAVTGVLVFTSTPDKESNKYYLGPAPIEEWQANCYCNWALRKYREYLFLLEKAC* | |||
Physicochemical properties | |||
| Number of amino acids: | 116 | ||
| Molecular weight: | 13,690.889 | ||
| Theoretical pI: | 9.635 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 29450 29700 | ||
| Instability index: | 31.385 | ||
| aromaticity | 0.129 | ||
| GRAVY | -0.573 | ||
Secondary Structure Fraction | |||
| Helix | 0.276 | ||
| turn | 0.164 | ||
| sheet | 0.302 | ||