| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >BM005636.1 | 5prime_partial | 106 | 2-322(+) |
Amino Acid sequence : | |||
| TSVKWRSPLPAPSLCMRSIRRRRTQSTPTSTRSRRRLLLLLPWRAEDTLSTRSTRRRNRRTKPSRAVRRSITTSSKLSKVWTETFYLMFMLTEISSVLYLIYPNKS* | |||
Physicochemical properties | |||
| Number of amino acids: | 106 | ||
| Molecular weight: | 12,589.594 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 20970 | ||
| Instability index: | 117.757 | ||
| aromaticity | 0.075 | ||
| GRAVY | -0.677 | ||
Secondary Structure Fraction | |||
| Helix | 0.274 | ||
| turn | 0.245 | ||
| sheet | 0.208 | ||