Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>BM005636.1 | 5prime_partial | 106 | 2-322(+) |
Amino Acid sequence : | |||
TSVKWRSPLPAPSLCMRSIRRRRTQSTPTSTRSRRRLLLLLPWRAEDTLSTRSTRRRNRRTKPSRAVRRSITTSSKLSKVWTETFYLMFMLTEISSVLYLIYPNKS* | |||
Physicochemical properties | |||
Number of amino acids: | 106 | ||
Molecular weight: | 12,589.594 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 20970 | ||
Instability index: | 117.757 | ||
aromaticity | 0.075 | ||
GRAVY | -0.677 | ||
Secondary Structure Fraction | |||
Helix | 0.274 | ||
turn | 0.245 | ||
sheet | 0.208 |