| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >BM027648.1 | 5prime_partial | 140 | 3-425(+) |
Amino Acid sequence : | |||
| QPYSADHHDDIVPSLHFALHVRDESEGAVPMVLNFAGDVLELQRSRTEAAFHQGQYLLTSQRSSSLDLAIYTPLKQLFTVLYIYLYRILYILFRTLLDIYHHHSLCQVMIVCPFRFLKLL IVVVLHEFDLLHCSSSLFYK* | |||
Physicochemical properties | |||
| Number of amino acids: | 140 | ||
| Molecular weight: | 16,338.809 | ||
| Theoretical pI: | 6.354 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13410 13535 | ||
| Instability index: | 37.067 | ||
| aromaticity | 0.129 | ||
| GRAVY | 0.311 | ||
Secondary Structure Fraction | |||
| Helix | 0.443 | ||
| turn | 0.150 | ||
| sheet | 0.279 | ||