Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>BM027648.1 | 5prime_partial | 140 | 3-425(+) |
Amino Acid sequence : | |||
QPYSADHHDDIVPSLHFALHVRDESEGAVPMVLNFAGDVLELQRSRTEAAFHQGQYLLTSQRSSSLDLAIYTPLKQLFTVLYIYLYRILYILFRTLLDIYHHHSLCQVMIVCPFRFLKLL IVVVLHEFDLLHCSSSLFYK* | |||
Physicochemical properties | |||
Number of amino acids: | 140 | ||
Molecular weight: | 16,338.809 | ||
Theoretical pI: | 6.354 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13410 13535 | ||
Instability index: | 37.067 | ||
aromaticity | 0.129 | ||
GRAVY | 0.311 | ||
Secondary Structure Fraction | |||
Helix | 0.443 | ||
turn | 0.150 | ||
sheet | 0.279 |