| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >BM956289.1 | internal | 153 | 1-459(+) |
Amino Acid sequence : | |||
| DFRLRGLLTEYGEVVAKSRTALDKAIPSVLAKLVERLPAMLIESLRELWNDLEKLDKQIADIERRLQMWLKEDKACKAIAAIPGVGLLTATAAVATMGDPKSFKSGREFAAWLGLVPAQT GTGGKVKLLGISKRGDTYLRTLLVHGARSRKSL | |||
Physicochemical properties | |||
| Number of amino acids: | 153 | ||
| Molecular weight: | 16,741.502 | ||
| Theoretical pI: | 9.894 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19480 | ||
| Instability index: | 37.375 | ||
| aromaticity | 0.052 | ||
| GRAVY | -0.046 | ||
Secondary Structure Fraction | |||
| Helix | 0.314 | ||
| turn | 0.176 | ||
| sheet | 0.353 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >BM956289.1 | internal | 153 | 1-459(+) |
Amino Acid sequence : | |||
| DFRLRGLLTEYGEVVAKSRTALDKAIPSVLAKLVERLPAMLIESLRELWNDLEKLDKQIADIERRLQMWLKEDKACKAIAAIPGVGLLTATAAVATMGDPKSFKSGREFAAWLGLVPAQT GTGGKVKLLGISKRGDTYLRTLLVHGARSRKSL | |||
Physicochemical properties | |||
| Number of amino acids: | 153 | ||
| Molecular weight: | 16,741.502 | ||
| Theoretical pI: | 9.894 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19480 | ||
| Instability index: | 37.375 | ||
| aromaticity | 0.052 | ||
| GRAVY | -0.046 | ||
Secondary Structure Fraction | |||
| Helix | 0.314 | ||
| turn | 0.176 | ||
| sheet | 0.353 | ||