| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >BM956292.1 | internal | 113 | 340-2(-) |
Amino Acid sequence : | |||
| WAKIEANYLTKTLTNRIYLESMLYACKMDEGTLIQDHINKFDRIVSDLKDIEVDVEDEDQALLLLLSLPRPFENLVQTLMLVGNRDTRTMDETRASLSADDLRKVATNGMATV | |||
Physicochemical properties | |||
| Number of amino acids: | 113 | ||
| Molecular weight: | 12,906.627 | ||
| Theoretical pI: | 4.599 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 9970 | ||
| Instability index: | 33.035 | ||
| aromaticity | 0.053 | ||
| GRAVY | -0.237 | ||
Secondary Structure Fraction | |||
| Helix | 0.319 | ||
| turn | 0.142 | ||
| sheet | 0.336 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >BM956292.1 | internal | 113 | 340-2(-) |
Amino Acid sequence : | |||
| WAKIEANYLTKTLTNRIYLESMLYACKMDEGTLIQDHINKFDRIVSDLKDIEVDVEDEDQALLLLLSLPRPFENLVQTLMLVGNRDTRTMDETRASLSADDLRKVATNGMATV | |||
Physicochemical properties | |||
| Number of amino acids: | 113 | ||
| Molecular weight: | 12,906.627 | ||
| Theoretical pI: | 4.599 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 9970 | ||
| Instability index: | 33.035 | ||
| aromaticity | 0.053 | ||
| GRAVY | -0.237 | ||
Secondary Structure Fraction | |||
| Helix | 0.319 | ||
| turn | 0.142 | ||
| sheet | 0.336 | ||