Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>BM956306.1 | 5prime_partial | 100 | 332-30(-) |
Amino Acid sequence : | |||
IAAIQPHHFNSYQSIFNHQVFGSASGSTYNNNNEMIKMEQSLVSVSQETCLSSDVNANMTTTTEVSSGPVMKQEMGMMGMVNGSKSYEDLCDLRGDLWDF* | |||
Physicochemical properties | |||
Number of amino acids: | 100 | ||
Molecular weight: | 11,052.176 | ||
Theoretical pI: | 4.523 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
Instability index: | 44.642 | ||
aromaticity | 0.080 | ||
GRAVY | -0.380 | ||
Secondary Structure Fraction | |||
Helix | 0.240 | ||
turn | 0.320 | ||
sheet | 0.230 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>BM956306.1 | 5prime_partial | 100 | 332-30(-) |
Amino Acid sequence : | |||
IAAIQPHHFNSYQSIFNHQVFGSASGSTYNNNNEMIKMEQSLVSVSQETCLSSDVNANMTTTTEVSSGPVMKQEMGMMGMVNGSKSYEDLCDLRGDLWDF* | |||
Physicochemical properties | |||
Number of amino acids: | 100 | ||
Molecular weight: | 11,052.176 | ||
Theoretical pI: | 4.523 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
Instability index: | 44.642 | ||
aromaticity | 0.080 | ||
GRAVY | -0.380 | ||
Secondary Structure Fraction | |||
Helix | 0.240 | ||
turn | 0.320 | ||
sheet | 0.230 |