| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >BM956306.1 | 5prime_partial | 100 | 332-30(-) |
Amino Acid sequence : | |||
| IAAIQPHHFNSYQSIFNHQVFGSASGSTYNNNNEMIKMEQSLVSVSQETCLSSDVNANMTTTTEVSSGPVMKQEMGMMGMVNGSKSYEDLCDLRGDLWDF* | |||
Physicochemical properties | |||
| Number of amino acids: | 100 | ||
| Molecular weight: | 11,052.176 | ||
| Theoretical pI: | 4.523 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
| Instability index: | 44.642 | ||
| aromaticity | 0.080 | ||
| GRAVY | -0.380 | ||
Secondary Structure Fraction | |||
| Helix | 0.240 | ||
| turn | 0.320 | ||
| sheet | 0.230 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >BM956306.1 | 5prime_partial | 100 | 332-30(-) |
Amino Acid sequence : | |||
| IAAIQPHHFNSYQSIFNHQVFGSASGSTYNNNNEMIKMEQSLVSVSQETCLSSDVNANMTTTTEVSSGPVMKQEMGMMGMVNGSKSYEDLCDLRGDLWDF* | |||
Physicochemical properties | |||
| Number of amino acids: | 100 | ||
| Molecular weight: | 11,052.176 | ||
| Theoretical pI: | 4.523 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
| Instability index: | 44.642 | ||
| aromaticity | 0.080 | ||
| GRAVY | -0.380 | ||
Secondary Structure Fraction | |||
| Helix | 0.240 | ||
| turn | 0.320 | ||
| sheet | 0.230 | ||