Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>BM956310.1 | internal | 176 | 529-2(-) |
Amino Acid sequence : | |||
SKIKTRSMMRRGLQLGHHHVVPSKSSIISITSTNLSFMGQPVVAPIRSCNFIPLKNELSFLGLLTLLMSSLIFPSNNGSPTNTEYVSNSMHPCYHHPLFIHSNCDVHNLIEKISLPMPAM KGLGEDVIGESELCLAVLAAVDLAVKVYEEKPTHFRIPNPILLLSYSYFLISIQTK | |||
Physicochemical properties | |||
Number of amino acids: | 176 | ||
Molecular weight: | 14,534.445 | ||
Theoretical pI: | 7.080 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23950 24200 | ||
Instability index: | 20.979 | ||
aromaticity | 0.101 | ||
GRAVY | -0.288 | ||
Secondary Structure Fraction | |||
Helix | 0.302 | ||
turn | 0.194 | ||
sheet | 0.217 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>BM956310.1 | complete | 129 | 68-457(+) |
Amino Acid sequence : | |||
MGRLFLIHLDGKIYSCKHCQTQLALSDDILSKTFHCRHGKAYLFNKVVNITVGVNEERMMITGMHTVADIFCVSWGSIVGWKYEAAHEKSQKSKEGKFILERYKVTGPDGSHYWLTHEAQ VGGSDADDA* | |||
Physicochemical properties | |||
Number of amino acids: | 129 | ||
Molecular weight: | 14,534.445 | ||
Theoretical pI: | 7.080 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23950 24200 | ||
Instability index: | 20.979 | ||
aromaticity | 0.101 | ||
GRAVY | -0.288 | ||
Secondary Structure Fraction | |||
Helix | 0.302 | ||
turn | 0.194 | ||
sheet | 0.217 |