| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >BM956316.1 | internal | 134 | 404-3(-) |
Amino Acid sequence : | |||
| FALQRPWKPFNPILGETYEMVNHGGVTFIAEQVSHHPPISAGHAENEHFTYDITSKVRTKLLGNSVDIYPIGRTRVTLKKSGIVLDLVPPPTKVNNLIFGRTWIDSPGEMVMTNLTTGDK VVLSFQPCGWFDSG | |||
Physicochemical properties | |||
| Number of amino acids: | 134 | ||
| Molecular weight: | 14,891.883 | ||
| Theoretical pI: | 7.147 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 20970 | ||
| Instability index: | 20.505 | ||
| aromaticity | 0.097 | ||
| GRAVY | -0.169 | ||
Secondary Structure Fraction | |||
| Helix | 0.328 | ||
| turn | 0.284 | ||
| sheet | 0.172 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >BM956316.1 | internal | 134 | 404-3(-) |
Amino Acid sequence : | |||
| FALQRPWKPFNPILGETYEMVNHGGVTFIAEQVSHHPPISAGHAENEHFTYDITSKVRTKLLGNSVDIYPIGRTRVTLKKSGIVLDLVPPPTKVNNLIFGRTWIDSPGEMVMTNLTTGDK VVLSFQPCGWFDSG | |||
Physicochemical properties | |||
| Number of amino acids: | 134 | ||
| Molecular weight: | 14,891.883 | ||
| Theoretical pI: | 7.147 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 20970 | ||
| Instability index: | 20.505 | ||
| aromaticity | 0.097 | ||
| GRAVY | -0.169 | ||
Secondary Structure Fraction | |||
| Helix | 0.328 | ||
| turn | 0.284 | ||
| sheet | 0.172 | ||