Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>BM956319.1 | 5prime_partial | 159 | 2-481(+) |
Amino Acid sequence : | |||
IGRLQKLQAEMFKRSNSGINLKFDNSSCTPAMSSTRSFLSSLSTEGSVASLQGKPFQLIGGSLSSEPVNLHPTPKRRCLCTGRGEDGKCAASGRCHCSKRRKLRVKRSIKVPAISNKLAD IPPDEFSWRKYGQKPIKGSPHPRGYYKCSSITSYLLFNH* | |||
Physicochemical properties | |||
Number of amino acids: | 159 | ||
Molecular weight: | 11,484.253 | ||
Theoretical pI: | 5.819 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16500 | ||
Instability index: | 65.037 | ||
aromaticity | 0.089 | ||
GRAVY | 0.044 | ||
Secondary Structure Fraction | |||
Helix | 0.356 | ||
turn | 0.257 | ||
sheet | 0.337 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>BM956319.1 | complete | 101 | 327-22(-) |
Amino Acid sequence : | |||
MDLLTRSFLLLEQWHLPLAAHFPSSPLPVQRHLRFGVGWRFTGSDDSEPPMSWNGFPCRLATLPSVLREDKKDLVDDMAGVQLELSNLRFMPLLLLLNISA* | |||
Physicochemical properties | |||
Number of amino acids: | 101 | ||
Molecular weight: | 11,484.253 | ||
Theoretical pI: | 5.819 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16500 | ||
Instability index: | 65.037 | ||
aromaticity | 0.089 | ||
GRAVY | 0.044 | ||
Secondary Structure Fraction | |||
Helix | 0.356 | ||
turn | 0.257 | ||
sheet | 0.337 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>BM956319.1 | 5prime_partial | 159 | 2-481(+) |
Amino Acid sequence : | |||
IGRLQKLQAEMFKRSNSGINLKFDNSSCTPAMSSTRSFLSSLSTEGSVASLQGKPFQLIGGSLSSEPVNLHPTPKRRCLCTGRGEDGKCAASGRCHCSKRRKLRVKRSIKVPAISNKLAD IPPDEFSWRKYGQKPIKGSPHPRGYYKCSSITSYLLFNH* | |||
Physicochemical properties | |||
Number of amino acids: | 159 | ||
Molecular weight: | 11,484.253 | ||
Theoretical pI: | 5.819 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16500 | ||
Instability index: | 65.037 | ||
aromaticity | 0.089 | ||
GRAVY | 0.044 | ||
Secondary Structure Fraction | |||
Helix | 0.356 | ||
turn | 0.257 | ||
sheet | 0.337 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>BM956319.1 | complete | 101 | 327-22(-) |
Amino Acid sequence : | |||
MDLLTRSFLLLEQWHLPLAAHFPSSPLPVQRHLRFGVGWRFTGSDDSEPPMSWNGFPCRLATLPSVLREDKKDLVDDMAGVQLELSNLRFMPLLLLLNISA* | |||
Physicochemical properties | |||
Number of amino acids: | 101 | ||
Molecular weight: | 11,484.253 | ||
Theoretical pI: | 5.819 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16500 | ||
Instability index: | 65.037 | ||
aromaticity | 0.089 | ||
GRAVY | 0.044 | ||
Secondary Structure Fraction | |||
Helix | 0.356 | ||
turn | 0.257 | ||
sheet | 0.337 |