| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >BM956320.1 | internal | 190 | 571-2(-) |
Amino Acid sequence : | |||
| QITPELSKCKLLTFVDLSQNNLSGEIPVEITGMRILNYLNLSRNHLEGNIPASISSMQSLTSVDFSYNNLSGLVPVTGQFSYLNSTSFVGNSDLCGPYLGPCKTGITDSSNQEHSKSSLS GCLKLLLVIGLLICSIAFAVVAILKARALKKASEARAWKLTAFQRLDFNCDDVLDCLKEENIIGKGGAGI | |||
Physicochemical properties | |||
| Number of amino acids: | 190 | ||
| Molecular weight: | 20,419.309 | ||
| Theoretical pI: | 6.887 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11835 | ||
| Instability index: | 26.626 | ||
| aromaticity | 0.063 | ||
| GRAVY | 0.165 | ||
Secondary Structure Fraction | |||
| Helix | 0.337 | ||
| turn | 0.300 | ||
| sheet | 0.258 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >BM956320.1 | internal | 190 | 571-2(-) |
Amino Acid sequence : | |||
| QITPELSKCKLLTFVDLSQNNLSGEIPVEITGMRILNYLNLSRNHLEGNIPASISSMQSLTSVDFSYNNLSGLVPVTGQFSYLNSTSFVGNSDLCGPYLGPCKTGITDSSNQEHSKSSLS GCLKLLLVIGLLICSIAFAVVAILKARALKKASEARAWKLTAFQRLDFNCDDVLDCLKEENIIGKGGAGI | |||
Physicochemical properties | |||
| Number of amino acids: | 190 | ||
| Molecular weight: | 20,419.309 | ||
| Theoretical pI: | 6.887 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11835 | ||
| Instability index: | 26.626 | ||
| aromaticity | 0.063 | ||
| GRAVY | 0.165 | ||
Secondary Structure Fraction | |||
| Helix | 0.337 | ||
| turn | 0.300 | ||
| sheet | 0.258 | ||