| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >BM956323.1 | 3prime_partial | 161 | 484-2(-) |
Amino Acid sequence : | |||
| MTRLGITNSWGGWSISGGTITNPGIWSYEGVAGAHIVFSGLCFLAAIWHWVYWDLEIFCDERTGKPSLDLPKIFGIHLLLSGVACFGFGAFHVTGLYGPGIWVSDPYGLTGKVQSVNPAW GAEGFDPFVPGGVASHHIAAGTLGILAGLFHLSVTSYLVSN | |||
Physicochemical properties | |||
| Number of amino acids: | 161 | ||
| Molecular weight: | 14,914.041 | ||
| Theoretical pI: | 9.518 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18450 | ||
| Instability index: | 64.786 | ||
| aromaticity | 0.098 | ||
| GRAVY | -0.721 | ||
Secondary Structure Fraction | |||
| Helix | 0.350 | ||
| turn | 0.220 | ||
| sheet | 0.220 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >BM956323.1 | complete | 123 | 58-429(+) |
Amino Acid sequence : | |||
| MYPLQYDERLLLPEQKDQNPPHPTLDLQIVLFRLVHKDRIPIFQDHIILLHEMHQSQNKLLLREVNEFQRSWANPKKVFPYVHHRIFLDPNIPNARWLPRNTSQKTQYVPLPRLHNSKYP DSL* | |||
Physicochemical properties | |||
| Number of amino acids: | 123 | ||
| Molecular weight: | 14,914.041 | ||
| Theoretical pI: | 9.518 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18450 | ||
| Instability index: | 64.786 | ||
| aromaticity | 0.098 | ||
| GRAVY | -0.721 | ||
Secondary Structure Fraction | |||
| Helix | 0.350 | ||
| turn | 0.220 | ||
| sheet | 0.220 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >BM956323.1 | 3prime_partial | 161 | 484-2(-) |
Amino Acid sequence : | |||
| MTRLGITNSWGGWSISGGTITNPGIWSYEGVAGAHIVFSGLCFLAAIWHWVYWDLEIFCDERTGKPSLDLPKIFGIHLLLSGVACFGFGAFHVTGLYGPGIWVSDPYGLTGKVQSVNPAW GAEGFDPFVPGGVASHHIAAGTLGILAGLFHLSVTSYLVSN | |||
Physicochemical properties | |||
| Number of amino acids: | 161 | ||
| Molecular weight: | 14,914.041 | ||
| Theoretical pI: | 9.518 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18450 | ||
| Instability index: | 64.786 | ||
| aromaticity | 0.098 | ||
| GRAVY | -0.721 | ||
Secondary Structure Fraction | |||
| Helix | 0.350 | ||
| turn | 0.220 | ||
| sheet | 0.220 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >BM956323.1 | complete | 123 | 58-429(+) |
Amino Acid sequence : | |||
| MYPLQYDERLLLPEQKDQNPPHPTLDLQIVLFRLVHKDRIPIFQDHIILLHEMHQSQNKLLLREVNEFQRSWANPKKVFPYVHHRIFLDPNIPNARWLPRNTSQKTQYVPLPRLHNSKYP DSL* | |||
Physicochemical properties | |||
| Number of amino acids: | 123 | ||
| Molecular weight: | 14,914.041 | ||
| Theoretical pI: | 9.518 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18450 | ||
| Instability index: | 64.786 | ||
| aromaticity | 0.098 | ||
| GRAVY | -0.721 | ||
Secondary Structure Fraction | |||
| Helix | 0.350 | ||
| turn | 0.220 | ||
| sheet | 0.220 | ||