| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >BM956333.1 | 3prime_partial | 104 | 97-408(+) |
Amino Acid sequence : | |||
| MLVFPIIFYALRLNFDGLCFPTRRSLSSENWRFAFVSALLLFLIFFAANFIPSIWDAFQFTGATAAVCLGFIFPSIIALKDPHGVARKKDKLLSCFMIVLGVAN | |||
Physicochemical properties | |||
| Number of amino acids: | 104 | ||
| Molecular weight: | 11,671.827 | ||
| Theoretical pI: | 9.352 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12615 | ||
| Instability index: | 35.252 | ||
| aromaticity | 0.173 | ||
| GRAVY | 0.930 | ||
Secondary Structure Fraction | |||
| Helix | 0.452 | ||
| turn | 0.202 | ||
| sheet | 0.279 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >BM956333.1 | 3prime_partial | 104 | 97-408(+) |
Amino Acid sequence : | |||
| MLVFPIIFYALRLNFDGLCFPTRRSLSSENWRFAFVSALLLFLIFFAANFIPSIWDAFQFTGATAAVCLGFIFPSIIALKDPHGVARKKDKLLSCFMIVLGVAN | |||
Physicochemical properties | |||
| Number of amino acids: | 104 | ||
| Molecular weight: | 11,671.827 | ||
| Theoretical pI: | 9.352 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12615 | ||
| Instability index: | 35.252 | ||
| aromaticity | 0.173 | ||
| GRAVY | 0.930 | ||
Secondary Structure Fraction | |||
| Helix | 0.452 | ||
| turn | 0.202 | ||
| sheet | 0.279 | ||