| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >BM956335.1 | 3prime_partial | 159 | 3-479(+) |
Amino Acid sequence : | |||
| MGYTGTTMKSVGSAALKMVEEVRRQFNTIPGLMEGTTKPDYATCVKISTDASIKEMIPPGCLVMLTPLIVGTFFGVETLSGVLAGSLVSGVQIAISASNTGGAWDNAKKYIEAGASEHAK SLGPKGSDPHMAAVIGDTIGDPLKDTSGPSLNILIKLVP | |||
Physicochemical properties | |||
| Number of amino acids: | 159 | ||
| Molecular weight: | 12,797.640 | ||
| Theoretical pI: | 5.731 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12490 | ||
| Instability index: | 40.526 | ||
| aromaticity | 0.076 | ||
| GRAVY | 0.029 | ||
Secondary Structure Fraction | |||
| Helix | 0.252 | ||
| turn | 0.294 | ||
| sheet | 0.269 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >BM956335.1 | 5prime_partial | 119 | 481-122(-) |
Amino Acid sequence : | |||
| TGTSFMRMLSDGPDVSLRGSPMVSPITAAMWGSDPFGPRLFACSEAPASMYFFALSQAPPVLEAEIAIWTPETREPARTPDRVSTPKKVPTMRGVSITRQPGGIISLMEASVEIFTHVA* | |||
Physicochemical properties | |||
| Number of amino acids: | 119 | ||
| Molecular weight: | 12,797.640 | ||
| Theoretical pI: | 5.731 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12490 | ||
| Instability index: | 40.526 | ||
| aromaticity | 0.076 | ||
| GRAVY | 0.029 | ||
Secondary Structure Fraction | |||
| Helix | 0.252 | ||
| turn | 0.294 | ||
| sheet | 0.269 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >BM956335.1 | 3prime_partial | 159 | 3-479(+) |
Amino Acid sequence : | |||
| MGYTGTTMKSVGSAALKMVEEVRRQFNTIPGLMEGTTKPDYATCVKISTDASIKEMIPPGCLVMLTPLIVGTFFGVETLSGVLAGSLVSGVQIAISASNTGGAWDNAKKYIEAGASEHAK SLGPKGSDPHMAAVIGDTIGDPLKDTSGPSLNILIKLVP | |||
Physicochemical properties | |||
| Number of amino acids: | 159 | ||
| Molecular weight: | 12,797.640 | ||
| Theoretical pI: | 5.731 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12490 | ||
| Instability index: | 40.526 | ||
| aromaticity | 0.076 | ||
| GRAVY | 0.029 | ||
Secondary Structure Fraction | |||
| Helix | 0.252 | ||
| turn | 0.294 | ||
| sheet | 0.269 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >BM956335.1 | 5prime_partial | 119 | 481-122(-) |
Amino Acid sequence : | |||
| TGTSFMRMLSDGPDVSLRGSPMVSPITAAMWGSDPFGPRLFACSEAPASMYFFALSQAPPVLEAEIAIWTPETREPARTPDRVSTPKKVPTMRGVSITRQPGGIISLMEASVEIFTHVA* | |||
Physicochemical properties | |||
| Number of amino acids: | 119 | ||
| Molecular weight: | 12,797.640 | ||
| Theoretical pI: | 5.731 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12490 | ||
| Instability index: | 40.526 | ||
| aromaticity | 0.076 | ||
| GRAVY | 0.029 | ||
Secondary Structure Fraction | |||
| Helix | 0.252 | ||
| turn | 0.294 | ||
| sheet | 0.269 | ||