| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >BM956340.1 | internal | 107 | 323-3(-) |
Amino Acid sequence : | |||
| ITAVQLKEGQEITISTDYSIKGDEEMITMSYKKLPVDLKPGNTILCADGTITLTVLSCDPGAGTVRCRCENTAMLGERKNVNLPGVVVDLPTITEKDKEDILECGNH | |||
Physicochemical properties | |||
| Number of amino acids: | 107 | ||
| Molecular weight: | 11,582.183 | ||
| Theoretical pI: | 4.664 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3230 | ||
| Instability index: | 28.686 | ||
| aromaticity | 0.019 | ||
| GRAVY | -0.189 | ||
Secondary Structure Fraction | |||
| Helix | 0.271 | ||
| turn | 0.215 | ||
| sheet | 0.243 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >BM956340.1 | internal | 107 | 323-3(-) |
Amino Acid sequence : | |||
| ITAVQLKEGQEITISTDYSIKGDEEMITMSYKKLPVDLKPGNTILCADGTITLTVLSCDPGAGTVRCRCENTAMLGERKNVNLPGVVVDLPTITEKDKEDILECGNH | |||
Physicochemical properties | |||
| Number of amino acids: | 107 | ||
| Molecular weight: | 11,582.183 | ||
| Theoretical pI: | 4.664 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3230 | ||
| Instability index: | 28.686 | ||
| aromaticity | 0.019 | ||
| GRAVY | -0.189 | ||
Secondary Structure Fraction | |||
| Helix | 0.271 | ||
| turn | 0.215 | ||
| sheet | 0.243 | ||