| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >BM956341.1 | internal | 146 | 3-440(+) |
Amino Acid sequence : | |||
| RDDVILVTYFALHGKERLFVIGCMCAALTVGMYAAPLAAMRLVVQTRSVEFMPFSLSFFLFLNAGVWSAYAVLVKDFFIGIPNGIGFVLGTGQLILYAIYRKKTPSPTEDDSEKEADKSV GDLEMAAKDINLQKGISFPKPSVSVS | |||
Physicochemical properties | |||
| Number of amino acids: | 146 | ||
| Molecular weight: | 15,965.517 | ||
| Theoretical pI: | 6.780 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13075 | ||
| Instability index: | 33.450 | ||
| aromaticity | 0.116 | ||
| GRAVY | 0.411 | ||
Secondary Structure Fraction | |||
| Helix | 0.377 | ||
| turn | 0.219 | ||
| sheet | 0.274 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >BM956341.1 | internal | 146 | 3-440(+) |
Amino Acid sequence : | |||
| RDDVILVTYFALHGKERLFVIGCMCAALTVGMYAAPLAAMRLVVQTRSVEFMPFSLSFFLFLNAGVWSAYAVLVKDFFIGIPNGIGFVLGTGQLILYAIYRKKTPSPTEDDSEKEADKSV GDLEMAAKDINLQKGISFPKPSVSVS | |||
Physicochemical properties | |||
| Number of amino acids: | 146 | ||
| Molecular weight: | 15,965.517 | ||
| Theoretical pI: | 6.780 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13075 | ||
| Instability index: | 33.450 | ||
| aromaticity | 0.116 | ||
| GRAVY | 0.411 | ||
Secondary Structure Fraction | |||
| Helix | 0.377 | ||
| turn | 0.219 | ||
| sheet | 0.274 | ||