| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >BM956342.1 | internal | 101 | 2-304(+) |
Amino Acid sequence : | |||
| ILVCLVXPMDECLARCALDISGRPHLEYKAEFNYQRVGDLSTEMVEHFFRSLSYAMACTLHLRTKGKNDHHRVESLFKAFGRTLRQAIRVDGNTKQTRITS | |||
Physicochemical properties | |||
| Number of amino acids: | 101 | ||
| Molecular weight: | 11,514.168 | ||
| Theoretical pI: | 9.074 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4720 | ||
| Instability index: | 41.772 | ||
| aromaticity | 0.080 | ||
| GRAVY | -0.315 | ||
Secondary Structure Fraction | |||
| Helix | 0.290 | ||
| turn | 0.160 | ||
| sheet | 0.270 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >BM956342.1 | internal | 101 | 2-304(+) |
Amino Acid sequence : | |||
| ILVCLVXPMDECLARCALDISGRPHLEYKAEFNYQRVGDLSTEMVEHFFRSLSYAMACTLHLRTKGKNDHHRVESLFKAFGRTLRQAIRVDGNTKQTRITS | |||
Physicochemical properties | |||
| Number of amino acids: | 101 | ||
| Molecular weight: | 11,514.168 | ||
| Theoretical pI: | 9.074 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4720 | ||
| Instability index: | 41.772 | ||
| aromaticity | 0.080 | ||
| GRAVY | -0.315 | ||
Secondary Structure Fraction | |||
| Helix | 0.290 | ||
| turn | 0.160 | ||
| sheet | 0.270 | ||