| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >BM956344.1 | 3prime_partial | 157 | 2-472(+) |
Amino Acid sequence : | |||
| MDIRSKARTLTGPISHPSQLPKWNYDGSSTGQAPGEDSVVILYPQAIFKDPFGRGNNILVICDCYTPAGVPIPTNKRANAARIFSDPKVVAEVPWYGIEQEYTLLQKDVQWPLGWPIGGY PGPQGPYYCGAGADKAFGRDIVDAHYKACLYAGMNIS | |||
Physicochemical properties | |||
| Number of amino acids: | 157 | ||
| Molecular weight: | 17,657.197 | ||
| Theoretical pI: | 10.102 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27960 28210 | ||
| Instability index: | 40.129 | ||
| aromaticity | 0.096 | ||
| GRAVY | -0.087 | ||
Secondary Structure Fraction | |||
| Helix | 0.350 | ||
| turn | 0.293 | ||
| sheet | 0.121 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >BM956344.1 | internal | 157 | 472-2(-) |
Amino Acid sequence : | |||
| TDVHTSIKTGFVVGINNITPKSLVSTRTTVIRSLGTRVSTNRPTKWPLDIFLQQSVLLLNPIPGYFSNYFRIAKNPSSICSFVGRDGHSCWSIAITYNKDVVPPPERILENGLRIQNDYT VFPWSLTCARSIVVPLWKLTRVADRPSKRPCFASNVH | |||
Physicochemical properties | |||
| Number of amino acids: | 157 | ||
| Molecular weight: | 17,657.197 | ||
| Theoretical pI: | 10.102 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27960 28210 | ||
| Instability index: | 40.129 | ||
| aromaticity | 0.096 | ||
| GRAVY | -0.087 | ||
Secondary Structure Fraction | |||
| Helix | 0.350 | ||
| turn | 0.293 | ||
| sheet | 0.121 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >BM956344.1 | 3prime_partial | 157 | 2-472(+) |
Amino Acid sequence : | |||
| MDIRSKARTLTGPISHPSQLPKWNYDGSSTGQAPGEDSVVILYPQAIFKDPFGRGNNILVICDCYTPAGVPIPTNKRANAARIFSDPKVVAEVPWYGIEQEYTLLQKDVQWPLGWPIGGY PGPQGPYYCGAGADKAFGRDIVDAHYKACLYAGMNIS | |||
Physicochemical properties | |||
| Number of amino acids: | 157 | ||
| Molecular weight: | 17,657.197 | ||
| Theoretical pI: | 10.102 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27960 28210 | ||
| Instability index: | 40.129 | ||
| aromaticity | 0.096 | ||
| GRAVY | -0.087 | ||
Secondary Structure Fraction | |||
| Helix | 0.350 | ||
| turn | 0.293 | ||
| sheet | 0.121 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >BM956344.1 | internal | 157 | 472-2(-) |
Amino Acid sequence : | |||
| TDVHTSIKTGFVVGINNITPKSLVSTRTTVIRSLGTRVSTNRPTKWPLDIFLQQSVLLLNPIPGYFSNYFRIAKNPSSICSFVGRDGHSCWSIAITYNKDVVPPPERILENGLRIQNDYT VFPWSLTCARSIVVPLWKLTRVADRPSKRPCFASNVH | |||
Physicochemical properties | |||
| Number of amino acids: | 157 | ||
| Molecular weight: | 17,657.197 | ||
| Theoretical pI: | 10.102 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27960 28210 | ||
| Instability index: | 40.129 | ||
| aromaticity | 0.096 | ||
| GRAVY | -0.087 | ||
Secondary Structure Fraction | |||
| Helix | 0.350 | ||
| turn | 0.293 | ||
| sheet | 0.121 | ||