| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >BM956346.1 | 5prime_partial | 166 | 538-38(-) |
Amino Acid sequence : | |||
| IPSSVVVDKMEQRLPEFMAKLSELGFMYRIRTLQENAENENEYAKFSIFLNSKLCRERLDYSSVSYNSDGSAEFVLGPDNPIEVRRGKRVWSKPFLVYSFDKIKTSFGDGSVIPEKAMST CRDILEENCVNVKWQKGDILVLDNHAVQHARRPGKPPRRILVSLCK* | |||
Physicochemical properties | |||
| Number of amino acids: | 166 | ||
| Molecular weight: | 19,060.688 | ||
| Theoretical pI: | 8.888 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18700 | ||
| Instability index: | 44.327 | ||
| aromaticity | 0.090 | ||
| GRAVY | -0.445 | ||
Secondary Structure Fraction | |||
| Helix | 0.313 | ||
| turn | 0.253 | ||
| sheet | 0.229 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >BM956346.1 | 5prime_partial | 166 | 538-38(-) |
Amino Acid sequence : | |||
| IPSSVVVDKMEQRLPEFMAKLSELGFMYRIRTLQENAENENEYAKFSIFLNSKLCRERLDYSSVSYNSDGSAEFVLGPDNPIEVRRGKRVWSKPFLVYSFDKIKTSFGDGSVIPEKAMST CRDILEENCVNVKWQKGDILVLDNHAVQHARRPGKPPRRILVSLCK* | |||
Physicochemical properties | |||
| Number of amino acids: | 166 | ||
| Molecular weight: | 19,060.688 | ||
| Theoretical pI: | 8.888 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18700 | ||
| Instability index: | 44.327 | ||
| aromaticity | 0.090 | ||
| GRAVY | -0.445 | ||
Secondary Structure Fraction | |||
| Helix | 0.313 | ||
| turn | 0.253 | ||
| sheet | 0.229 | ||