Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>BM956346.1 | 5prime_partial | 166 | 538-38(-) |
Amino Acid sequence : | |||
IPSSVVVDKMEQRLPEFMAKLSELGFMYRIRTLQENAENENEYAKFSIFLNSKLCRERLDYSSVSYNSDGSAEFVLGPDNPIEVRRGKRVWSKPFLVYSFDKIKTSFGDGSVIPEKAMST CRDILEENCVNVKWQKGDILVLDNHAVQHARRPGKPPRRILVSLCK* | |||
Physicochemical properties | |||
Number of amino acids: | 166 | ||
Molecular weight: | 19,060.688 | ||
Theoretical pI: | 8.888 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18700 | ||
Instability index: | 44.327 | ||
aromaticity | 0.090 | ||
GRAVY | -0.445 | ||
Secondary Structure Fraction | |||
Helix | 0.313 | ||
turn | 0.253 | ||
sheet | 0.229 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>BM956346.1 | 5prime_partial | 166 | 538-38(-) |
Amino Acid sequence : | |||
IPSSVVVDKMEQRLPEFMAKLSELGFMYRIRTLQENAENENEYAKFSIFLNSKLCRERLDYSSVSYNSDGSAEFVLGPDNPIEVRRGKRVWSKPFLVYSFDKIKTSFGDGSVIPEKAMST CRDILEENCVNVKWQKGDILVLDNHAVQHARRPGKPPRRILVSLCK* | |||
Physicochemical properties | |||
Number of amino acids: | 166 | ||
Molecular weight: | 19,060.688 | ||
Theoretical pI: | 8.888 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18700 | ||
Instability index: | 44.327 | ||
aromaticity | 0.090 | ||
GRAVY | -0.445 | ||
Secondary Structure Fraction | |||
Helix | 0.313 | ||
turn | 0.253 | ||
sheet | 0.229 |