| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >BM956380.1 | complete | 120 | 365-3(-) |
Amino Acid sequence : | |||
| MRKRHASRREKGGQVSGKRQGRNRRAHEGACQGETPGIFIVLSGFATSDLSVDFCDARQGGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAERPSAASQ * | |||
Physicochemical properties | |||
| Number of amino acids: | 120 | ||
| Molecular weight: | 13,004.767 | ||
| Theoretical pI: | 10.136 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15595 | ||
| Instability index: | 53.338 | ||
| aromaticity | 0.092 | ||
| GRAVY | -0.237 | ||
Secondary Structure Fraction | |||
| Helix | 0.267 | ||
| turn | 0.283 | ||
| sheet | 0.258 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >BM956380.1 | complete | 120 | 365-3(-) |
Amino Acid sequence : | |||
| MRKRHASRREKGGQVSGKRQGRNRRAHEGACQGETPGIFIVLSGFATSDLSVDFCDARQGGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAERPSAASQ * | |||
Physicochemical properties | |||
| Number of amino acids: | 120 | ||
| Molecular weight: | 13,004.767 | ||
| Theoretical pI: | 10.136 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15595 | ||
| Instability index: | 53.338 | ||
| aromaticity | 0.092 | ||
| GRAVY | -0.237 | ||
Secondary Structure Fraction | |||
| Helix | 0.267 | ||
| turn | 0.283 | ||
| sheet | 0.258 | ||