Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>BM956380.1 | complete | 120 | 365-3(-) |
Amino Acid sequence : | |||
MRKRHASRREKGGQVSGKRQGRNRRAHEGACQGETPGIFIVLSGFATSDLSVDFCDARQGGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAERPSAASQ * | |||
Physicochemical properties | |||
Number of amino acids: | 120 | ||
Molecular weight: | 13,004.767 | ||
Theoretical pI: | 10.136 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15595 | ||
Instability index: | 53.338 | ||
aromaticity | 0.092 | ||
GRAVY | -0.237 | ||
Secondary Structure Fraction | |||
Helix | 0.267 | ||
turn | 0.283 | ||
sheet | 0.258 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>BM956380.1 | complete | 120 | 365-3(-) |
Amino Acid sequence : | |||
MRKRHASRREKGGQVSGKRQGRNRRAHEGACQGETPGIFIVLSGFATSDLSVDFCDARQGGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAERPSAASQ * | |||
Physicochemical properties | |||
Number of amino acids: | 120 | ||
Molecular weight: | 13,004.767 | ||
Theoretical pI: | 10.136 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15595 | ||
Instability index: | 53.338 | ||
aromaticity | 0.092 | ||
GRAVY | -0.237 | ||
Secondary Structure Fraction | |||
Helix | 0.267 | ||
turn | 0.283 | ||
sheet | 0.258 |