| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >BM956410.1 | internal | 201 | 1-603(+) |
Amino Acid sequence : | |||
| FDSGLAVESGDWWDNFSKRITSGPLSKSRESNKFESVFKITRKTFNYICSLARENLMAKMNFVFSDGKPMCLEDQVAVALRRLSSGDSLLNIGAQFGLNHSTVSQVTWRFVEAMEERGFH HLRWPNAEEEMKAYKSKFEKVRGLPNCCGAIDTTHIMMCLPSVDPTNKLWLDHGKHHSMILQAVVDPEMRLGYRYGVARSQ | |||
Physicochemical properties | |||
| Number of amino acids: | 201 | ||
| Molecular weight: | 22,926.998 | ||
| Theoretical pI: | 8.603 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33460 33710 | ||
| Instability index: | 40.721 | ||
| aromaticity | 0.100 | ||
| GRAVY | -0.392 | ||
Secondary Structure Fraction | |||
| Helix | 0.284 | ||
| turn | 0.244 | ||
| sheet | 0.254 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >BM956410.1 | internal | 201 | 1-603(+) |
Amino Acid sequence : | |||
| FDSGLAVESGDWWDNFSKRITSGPLSKSRESNKFESVFKITRKTFNYICSLARENLMAKMNFVFSDGKPMCLEDQVAVALRRLSSGDSLLNIGAQFGLNHSTVSQVTWRFVEAMEERGFH HLRWPNAEEEMKAYKSKFEKVRGLPNCCGAIDTTHIMMCLPSVDPTNKLWLDHGKHHSMILQAVVDPEMRLGYRYGVARSQ | |||
Physicochemical properties | |||
| Number of amino acids: | 201 | ||
| Molecular weight: | 22,926.998 | ||
| Theoretical pI: | 8.603 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33460 33710 | ||
| Instability index: | 40.721 | ||
| aromaticity | 0.100 | ||
| GRAVY | -0.392 | ||
Secondary Structure Fraction | |||
| Helix | 0.284 | ||
| turn | 0.244 | ||
| sheet | 0.254 | ||