| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >BM956436.1 | internal | 167 | 501-1(-) |
Amino Acid sequence : | |||
| SIFGLGFITSITFISLIGVFMSSWLGASVLGIGEWFIKRMPFVRHIYNASKQISSAISPDQNTQAFKEVAIIRHPRIGEYAFAFITSSVVLQTYSGEEELFCVYVPTNHLYIGDIFLINS NDVIRPNLSVREGIEIVVSGGMSMPQILTTVESHRIQVDRTGPSQSR | |||
Physicochemical properties | |||
| Number of amino acids: | 167 | ||
| Molecular weight: | 18,575.158 | ||
| Theoretical pI: | 6.395 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18450 | ||
| Instability index: | 49.301 | ||
| aromaticity | 0.108 | ||
| GRAVY | 0.277 | ||
Secondary Structure Fraction | |||
| Helix | 0.383 | ||
| turn | 0.275 | ||
| sheet | 0.180 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >BM956436.1 | internal | 167 | 501-1(-) |
Amino Acid sequence : | |||
| SIFGLGFITSITFISLIGVFMSSWLGASVLGIGEWFIKRMPFVRHIYNASKQISSAISPDQNTQAFKEVAIIRHPRIGEYAFAFITSSVVLQTYSGEEELFCVYVPTNHLYIGDIFLINS NDVIRPNLSVREGIEIVVSGGMSMPQILTTVESHRIQVDRTGPSQSR | |||
Physicochemical properties | |||
| Number of amino acids: | 167 | ||
| Molecular weight: | 18,575.158 | ||
| Theoretical pI: | 6.395 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18450 | ||
| Instability index: | 49.301 | ||
| aromaticity | 0.108 | ||
| GRAVY | 0.277 | ||
Secondary Structure Fraction | |||
| Helix | 0.383 | ||
| turn | 0.275 | ||
| sheet | 0.180 | ||